TkA03G393340 | RubberDandelionOmics

Gene overview

TkA03G393340

Reference: TK1151 Chr: Chr03 Coordinates: 97597965-97606823 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA03G393340|TK1151|cDNA

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCAACCAGAAGAGCAAACTACCCAAGAAGA...

CDS

Download CDS FASTA

624 bp · TkA03G393340|TK1151|CDS

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCAACCAGAAGAGCAAACTACCCAAGAAGA...

Protein

Download Protein FASTA

207 aa · TkA03G393340|TK1151|PROTEIN

MGRRKLEIKRIQNKSSRLVAFSKRRSGLFKKARHLSVLCDVDVAAVVISDSGKVYEFSSGDTNSVGLILSRHPNSWLQPEEQTTQEEACKNMGLFSNLCTRFRTCKQLLESVKRVDEEPDEVSLTDMADLEQELTHALMHTRSRKTQLMMERISSFREQERILTEKNEQLKHQKYEVHDGGGDFANNHNNYQSSNTNQLLTLPPFKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G393340`
TK1151 ID	TkA03G393340
OH-1004 ID	LXL04_009018
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G393340

Location Chr03:97597965-97606823 (-)

Description Similar to AGL31: Agamous-like MADS-box protein AGL31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77080`	Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways.	No verified direct reference in this release
`At5g10140`	Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways.	No verified direct reference in this release
`At5g65080`	Transcription factor involved in the negative regulation of flowering time in short days, probably through the photoperiodic and vernalization pathways.	Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold.2003 · DOI: 10.1105/tpc.009506 The E2 ubiquitin-conjugating enzymes, AtUBC1 and AtUBC2, play redundant roles and are involved in activation of FLC expression and repression of flowering in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2008.03684.x The Plant Homeo Domain finger protein, VIN3-LIKE 2, is necessary for photoperiod-mediated epigenetic regulation of the floral repressor, MAF5.2010 · DOI: 10.1073/pnas.1010834107 Role of VIN3-LIKE 2 in facultative photoperiodic flowering response in Arabidopsis.2010 · DOI: 10.4161/psb.5.12.14035 AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2010.04402.x HISTONE DEACETYLASE6 interacts with FLOWERING LOCUS D and regulates flowering in Arabidopsis.2011 · DOI: 10.1104/pp.111.174417 Arabidopsis trithorax-related3/SET domain GROUP2 is required for the winter-annual habit of Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcs021
`At5g65050`	Probable transcription factor that prevents vernalization by short periods of cold.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0010048 vernalization response Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010094 specification of carpel identity Biological Process

KEGG gene cross-reference

ath:AT1G77080

ath:AT2G45650

ath:AT5G65050

ath:AT5G65060

dosa:Os02g0682200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA03G393340 · TK1151

Cytoplasm0.126

Rank 2 · TkA03G393340 · TK1151

Cell membrane0.025

Rank 3 · TkA03G393340 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA03G393340 · TK1151

Plastid0.010

Rank 5 · TkA03G393340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

PF01486K-box117-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G393340	`PF00319`	SRF-TF	10	57	2.5e-22	78.8
TkA03G393340	`PF01486`	K-box	117	173	2.3e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9AT76`	Arabidopsis thaliana	sp\|Q9AT76\|AGL27_ARATH Agamous-like MADS-box protein AGL27	45.900%	Swiss-Prot	Medium
`Q9S7Q7`	Arabidopsis thaliana	sp\|Q9S7Q7\|FLC_ARATH MADS-box protein FLOWERING LOCUS C	39.900%	Swiss-Prot	Medium
`Q683D7`	Arabidopsis thaliana	sp\|Q683D7\|MAF5_ARATH Protein MADS AFFECTING FLOWERING 5	41.900%	Swiss-Prot	Medium
`Q9FPN7`	Arabidopsis thaliana	sp\|Q9FPN7\|AGL31_ARATH Agamous-like MADS-box protein AGL31	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card