LXL04_009018 | RubberDandelionOmics

Gene overview

LXL04_009018

Reference: OH-1004 Chr: Chr02 Coordinates: 116262943-116271842 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_009018|LXL04_009018|OH1004|cDNA

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTCTAACTATCTATTTTTCTTACTTCAATGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCA...

CDS

Download CDS FASTA

651 bp · LXL04_009018|LXL04_009018|OH1004|CDS

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTCTAACTATCTATTTTTCTTACTTCAATGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCA...

Protein

Download Protein FASTA

216 aa · LXL04_009018|LXL04_009018|OH1004|PROTEIN

MGRRKLEIKRIQNKSSRLVAFSKRRSGLFKKARHLSVLCDVDVAAVVISDSGKVYEFSSGDTNSLTIYFSYFNVGLILSRHPNSWLQPEEQTTQEEACKNMGLFSNLCTRFRTCKQLLESVKRVDEEPDEVSLTDMADLEQELTHALMHTRSRKTQLMMERISSFREQERILTEKNEQLKHQKYEVHDGGGDFANNHNNYQSSNTNQLLTLPLFKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009018`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009018

Location Chr02:116262943-116271842 (-)

Description Similar to AGL31: Agamous-like MADS-box protein AGL31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65050`	Probable transcription factor that prevents vernalization by short periods of cold.	No verified direct reference in this release
`At5g65060`	Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv.	No verified direct reference in this release
`At1g77080`	Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways.	No verified direct reference in this release
`At2g45650`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0682200`	Probable transcription factor.	MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice.2009 · DOI: 10.1105/tpc.109.068742

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0010048 vernalization response Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010094 specification of carpel identity Biological Process

KEGG gene cross-reference

ath:AT1G77080

ath:AT2G45650

ath:AT5G65050

ath:AT5G65060

dosa:Os02g0682200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · LXL04_009018 · OH-1004

Cytoplasm0.144

Rank 2 · LXL04_009018 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_009018 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_009018 · OH-1004

Mitochondrion0.010

Rank 5 · LXL04_009018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF10-57 aa

PF01486.23K-box126-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009018	`PF00319.24`	SRF-TF	10	57	2.5e-22	78.7
LXL04_009018	`PF01486.23`	K-box	126	182	3e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPN7`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL31	37.668%	Swiss-Prot	moderate database homology
`Q9LSR7`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL70	40.217%	Swiss-Prot	moderate database homology
`Q9AT76`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL27	43.478%	Swiss-Prot	moderate database homology
`P29386`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL6	42.541%	Swiss-Prot	moderate database homology
`Q6EU39`	Oryza sativa subsp. japonica	MADS-box transcription factor 6	42.051%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card