RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG090170
Reference: TK1151 Chr: ChrUn Coordinates: 25598509-25603117 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3401 bp · TkAUNG090170|TK1151|cDNA

GATATTTGATTTTATTGTCGGCCATTACATGACTACAAACCTCCAATATTATCCATGGAAATGAAACTACCTTTGCAAATTCTGATCATTCATCTTATCATCTACATCTTCTTTATCGATAATTATGTCAGCTGCTATGGGCGATGGCAACGAATCTCGACCCTTCACCTCCTCCTCCATAGAATGCCATGCCTATGAATATCCTGAGATTCTCATAGCAACCAATAACTTTGACCAATCATTAGTAATTGGGGAAGGAG...

CDS

Download CDS FASTA

3162 bp · TkAUNG090170|TK1151|CDS

ATGTCAGCTGCTATGGGCGATGGCAACGAATCTCGACCCTTCACCTCCTCCTCCATAGAATGCCATGCCTATGAATATCCTGAGATTCTCATAGCAACCAATAACTTTGACCAATCATTAGTAATTGGGGAAGGAGGGTTTGGAATAGTTTACAAAGGTGAGTTTGTCAACGAATCAGGTGTTTTGGTTGCTGCCATTAAACGGTTGATCAATTCTGAGGTCACGCAAGCAGATTCTCAGTTCTGGGCGGAAGTTGAGAC...

Protein

Download Protein FASTA

1053 aa · TkAUNG090170|TK1151|PROTEIN

MSAAMGDGNESRPFTSSSIECHAYEYPEILIATNNFDQSLVIGEGGFGIVYKGEFVNESGVLVAAIKRLINSEVTQADSQFWAEVETLSKLRHCNLVPLIGYCSYGREMILVYQYMPNGTLEDNLHKLGTYISWRDRLQICLDAARGLDYLHTGTGIDVGIMHRDVKSSNILLDESWGAKISDFGLSILGPTDQPLNFVNAPVPITRGYVDLDYYYSGMLTSKCDVYNFGVVLLEVVCRKCALDSSLGEEQCVLVTWAQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG090170
TK1151 IDTkAUNG090170
OH-1004 IDLXL04_026027
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG090170
LocationChrUn:25598509-25603117 (+)
DescriptionSimilar to At5g61350: Probable receptor-like protein kinase At5g61350
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g61350 Probable receptor-like protein kinase At5g61350. No verified direct reference in this release
At3g51550 May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.
FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
At5g54380 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At5g02290 May play a role in the regulation of plant growth and development (Probable). No verified direct reference in this release
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0051924 regulation of calcium ion transport Biological Process
GO:0080147 root hair cell development Biological Process
GO:0097275 intracellular ammonium homeostasis Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G02290
ath:AT5G61350
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.517
Rank 1 · TkAUNG090170 · TK1151
Cytoplasm0.386
Rank 2 · TkAUNG090170 · TK1151
Nucleus0.225
Rank 3 · TkAUNG090170 · TK1151
Endoplasmic reticulum0.045
Rank 4 · TkAUNG090170 · TK1151
Golgi apparatus0.043
Rank 5 · TkAUNG090170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase40-309 aa
PF07714PK_Tyr_Ser-Thr41-310 aa
PF01636APH86-177 aa
PF17667Pkinase_fungal143-176 aa
PF03109ABC1155-187 aa
PF14531Kinase-like158-186 aa
PF03109ABC1270-301 aa
PF14531Kinase-like298-328 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG090170PF00069Pkinase403092.5e-119398.2
TkAUNG090170PF07714PK_Tyr_Ser-Thr413108.3e-127422.5
TkAUNG090170PF01636APH861770.0003621.1
TkAUNG090170PF17667Pkinase_fungal1431760.1611.3
TkAUNG090170PF03109ABC11551872.5e-0524.3
TkAUNG090170PF14531Kinase-like1581860.00218.2
TkAUNG090170PF03109ABC12703012.5e-0524.3
TkAUNG090170PF14531Kinase-like2983280.00218.2
TkAUNG090170PF07714PK_Tyr_Ser-Thr3685178.3e-127422.5
TkAUNG090170PF00069Pkinase3685282.5e-119398.2
TkAUNG090170PF03109ABC13693912.5e-0524.3
TkAUNG090170PF03109ABC14855272.5e-0524.3
TkAUNG090170PF01636APH4855000.0003621.1
TkAUNG090170PF17667Pkinase_fungal4855020.1611.3
TkAUNG090170PF00069Pkinase5286692.5e-119398.2
TkAUNG090170PF07714PK_Tyr_Ser-Thr5306718.3e-127422.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FLJ8Arabidopsis thalianasp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g6135043.600%Swiss-ProtLow
Q9SCZ4Arabidopsis thalianasp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA42.800%Swiss-ProtLow
Q9LK35Arabidopsis thalianasp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 144.700%Swiss-ProtLow
P43293Arabidopsis thalianasp|P43293|PBL11_ARATH Probable serine/threonine-protein kinase PBL1142.800%Swiss-ProtLow
Q9FID8Arabidopsis thalianasp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g3900045.800%Swiss-ProtLow

JBrowse

View in Genome Browser