LXL04_026027 | RubberDandelionOmics

Gene overview

LXL04_026027

Reference: OH-1004 Chr: Chr05 Coordinates: 119907953-119912325 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3165 bp · LXL04_026027|LXL04_026027|OH1004|cDNA

ATGTCAGCTGCTATGGGCGATGGCAACGAATCTCGACCCTTCACCTCCTCCTCCATAGAATGCCATGCCTATGAATATCCTGAGATTCTCATAGCAACCAATAACTTTGACCAATCATTAGTAATTGGGGAAGGAGGGTTTGGAATAGTTTACAAAGGTGAGTTTGTCAACGAATCAGGTGTTTTGGTTGCTGCCATTAAACGGTTGATCAATTCTGAGGTCACGCAAGCAGATTCTCAGTTCTGGGCGGAAGTTGAGAC...

CDS

Download CDS FASTA

3165 bp · LXL04_026027|LXL04_026027|OH1004|CDS

ATGTCAGCTGCTATGGGCGATGGCAACGAATCTCGACCCTTCACCTCCTCCTCCATAGAATGCCATGCCTATGAATATCCTGAGATTCTCATAGCAACCAATAACTTTGACCAATCATTAGTAATTGGGGAAGGAGGGTTTGGAATAGTTTACAAAGGTGAGTTTGTCAACGAATCAGGTGTTTTGGTTGCTGCCATTAAACGGTTGATCAATTCTGAGGTCACGCAAGCAGATTCTCAGTTCTGGGCGGAAGTTGAGAC...

Protein

Download Protein FASTA

1054 aa · LXL04_026027|LXL04_026027|OH1004|PROTEIN

MSAAMGDGNESRPFTSSSIECHAYEYPEILIATNNFDQSLVIGEGGFGIVYKGEFVNESGVLVAAIKRLINSEVTQADSQFWAEVETLSKLRHCNLVPLIGYCSYGREMILVYQYMPNGTLEDNLHKLGTYISWRDRLQICLDAARGLDYLHTGTGIDVGIMHRDVKSSNILLDESWGAKISDFGLSILGPTDQPLNFVNAPVPITRGYVDLDYYYSGMLTSKCDVYNFGVVLLEVVCRKRALDSSLGEEQCVLVTWAQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026027`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026027

Location Chr05:119907953-119912325 (+)

Description Similar to At5g61350: Probable receptor-like protein kinase At5g61350

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026027 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G02290

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.525

Rank 1 · LXL04_026027 · OH-1004

Cytoplasm0.381

Rank 2 · LXL04_026027 · OH-1004

Nucleus0.222

Rank 3 · LXL04_026027 · OH-1004

Endoplasmic reticulum0.045

Rank 4 · LXL04_026027 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_026027 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase40-310 aa

PF07714.24PK_Tyr_Ser-Thr41-311 aa

PF07714.24PK_Tyr_Ser-Thr369-518 aa

PF00069.32Pkinase369-529 aa

PF00069.32Pkinase529-670 aa

PF07714.24PK_Tyr_Ser-Thr531-672 aa

PF07714.24PK_Tyr_Ser-Thr780-1047 aa

PF00069.32Pkinase803-1045 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026027	`PF00069.32`	Pkinase	40	310	1.4e-119	399.1
LXL04_026027	`PF07714.24`	PK_Tyr_Ser-Thr	41	311	7.5e-127	422.7
LXL04_026027	`PF07714.24`	PK_Tyr_Ser-Thr	369	518	7.5e-127	422.7
LXL04_026027	`PF00069.32`	Pkinase	369	529	1.4e-119	399.1
LXL04_026027	`PF00069.32`	Pkinase	529	670	1.4e-119	399.1
LXL04_026027	`PF07714.24`	PK_Tyr_Ser-Thr	531	672	7.5e-127	422.7
LXL04_026027	`PF07714.24`	PK_Tyr_Ser-Thr	780	1047	7.5e-127	422.7
LXL04_026027	`PF00069.32`	Pkinase	803	1045	1.4e-119	399.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLJ8`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g61350	43.697%	Swiss-Prot	weak database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	42.857%	Swiss-Prot	weak database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	42.857%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	42.493%	Swiss-Prot	weak database homology
`P43293`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL11	42.810%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card