Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1455 bp · TkAUNG080980|TK1151|cDNA
AAATATCAAGGGCTAAAAAAGCAAAATACGAAATGTAAAGGACACTCTGTACTGTTAACTGTATGAACCTCTTCCCTCTCTTTTCTCTCTTCACCGTCTGTTCCCTCCAAGGCTCCAATGGAATTCGAACGTAACCAGGGGAAACTCGAAGAAACGGTGATTCAAATTCTCAAAAGTGCCGATTTAGAAATCGCCACGGAACTCGTTGTTCGAAGAGAGGCTGAAAGACTGCTTGGCGTCGACCTATCTGATATAGCTAG...
1260 bp · TkAUNG080980|TK1151|CDS
ATGGAATTCGAACGTAACCAGGGGAAACTCGAAGAAACGGTGATTCAAATTCTCAAAAGTGCCGATTTAGAAATCGCCACGGAACTCGTTGTTCGAAGAGAGGCTGAAAGACTGCTTGGCGTCGACCTATCTGATATAGCTAGCAAGCGGCTGGTTAGACGAGTTGTTGAGTCGTTTTTGTTGTCTACTTCGCCGGCCGATGAAGTTCGACAAGGAACAGAACAGGTGGATAAATCACCTACTGACAACAATCGAAATGT...
Protein
Download Protein FASTA419 aa · TkAUNG080980|TK1151|PROTEIN
MEFERNQGKLEETVIQILKSADLEIATELVVRREAERLLGVDLSDIASKRLVRRVVESFLLSTSPADEVRQGTEQVDKSPTDNNRNVVSDEGGGRVIFKLPGMMRVSLQKFKKTKLLSIREYYQKEQLMFPSGTGITLNPKEWSAFCSSFNDIEEAITKMESRTRSEGIGKKQTEAEVSNPRHPLIPIATTRFTGRNYYCWKRQMEFFLNQLRVSYVLFEPCPKIPFSPPASLKDISQAKSYLQQWTNDDYLCRHTILNS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG080980 |
|---|---|
| TK1151 ID | TkAUNG080980 |
| OH-1004 ID | LXL04_026640 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG080980 |
|---|---|
| Location | ChrUn:23074381-23077849 (-) |
| Description | Similar to KELP: RNA polymerase II transcriptional coactivator KELP |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001111 RNA polymerase II promoter clearance Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0045899 positive regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process GO:0051053 negative regulation of DNA metabolic process Biological Process GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005667 transcription regulator complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0070062 extracellular exosome Cellular Component |
| KEGG gene cross-reference | ath:AT4G10920 hsa:10923 mcf:101926874 pon:100173565 spo:2542309 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08766DEK_C9-60 aaPF02229PC499-148 aaPF08848DUF1818136-163 aaPF14223Retrotran_gag_2140-158 aaPF14244Retrotran_gag_3187-210 aaPF13961DUF4219193-209 aaPF14223Retrotran_gag_2238-384 aaPF23786Baseplate_wedge242-348 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG080980 | PF08766 | DEK_C | 9 | 60 | 6.1e-08 | 33.2 |
| TkAUNG080980 | PF02229 | PC4 | 99 | 148 | 8e-13 | 48.4 |
| TkAUNG080980 | PF08848 | DUF1818 | 136 | 163 | 0.2 | 12.5 |
| TkAUNG080980 | PF14223 | Retrotran_gag_2 | 140 | 158 | 4.2e-20 | 72.9 |
| TkAUNG080980 | PF14244 | Retrotran_gag_3 | 187 | 210 | 0.0063 | 17.0 |
| TkAUNG080980 | PF13961 | DUF4219 | 193 | 209 | 0.092 | 13.2 |
| TkAUNG080980 | PF14223 | Retrotran_gag_2 | 238 | 384 | 4.2e-20 | 72.9 |
| TkAUNG080980 | PF23786 | Baseplate_wedge | 242 | 348 | 0.033 | 14.4 |
| TkAUNG080980 | PF13696 | zf-CCHC_2 | 249 | 254 | 0.88 | 10.2 |
| TkAUNG080980 | PF08848 | DUF1818 | 259 | 285 | 0.2 | 12.5 |
| TkAUNG080980 | PF13961 | DUF4219 | 271 | 282 | 0.092 | 13.2 |
| TkAUNG080980 | PF08766 | DEK_C | 278 | 303 | 6.1e-08 | 33.2 |
| TkAUNG080980 | PF08848 | DUF1818 | 340 | 366 | 0.2 | 12.5 |
| TkAUNG080980 | PF00098 | zf-CCHC | 396 | 411 | 0.0066 | 17.2 |
| TkAUNG080980 | PF13696 | zf-CCHC_2 | 396 | 411 | 0.88 | 10.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.