LXL04_026640 | RubberDandelionOmics

Gene overview

LXL04_026640

Reference: OH-1004 Chr: Chr06 Coordinates: 755765-758052 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · LXL04_026640|LXL04_026640|OH1004|cDNA

ATGGAATTCGAACGTAACCAGGGGAAACTCGAAGAAACGGTGATTCAAATTCTCAAAAGTGCCGATTTAGAAATCGCCACGGAACTCGTTGTTCGAAGAGAGGCTGAAAGACTGCTTGGCGTCGACCTATCTGATATAGCTAGCAAGCGGCTGGTTAGACGAGTTGTTGAGTCGTTTTTGTTGTCTACTTCGCCGGCCGATGAAGTTCGACAAGGAACAGAACAGGTGGATAAATCACCTACTGACAACAATCGAAATGT...

CDS

Download CDS FASTA

1260 bp · LXL04_026640|LXL04_026640|OH1004|CDS

ATGGAATTCGAACGTAACCAGGGGAAACTCGAAGAAACGGTGATTCAAATTCTCAAAAGTGCCGATTTAGAAATCGCCACGGAACTCGTTGTTCGAAGAGAGGCTGAAAGACTGCTTGGCGTCGACCTATCTGATATAGCTAGCAAGCGGCTGGTTAGACGAGTTGTTGAGTCGTTTTTGTTGTCTACTTCGCCGGCCGATGAAGTTCGACAAGGAACAGAACAGGTGGATAAATCACCTACTGACAACAATCGAAATGT...

Protein

Download Protein FASTA

419 aa · LXL04_026640|LXL04_026640|OH1004|PROTEIN

MEFERNQGKLEETVIQILKSADLEIATELVVRREAERLLGVDLSDIASKRLVRRVVESFLLSTSPADEVRQGTEQVDKSPTDNNRNVVSDEGGGRVIFKLPGMMRVSLQKFKKTKLLSIREYYQKEQLMFPSGTGITLNPKEWSAFCSSFNDIEEAITKMESRTRSEGIGKKQTEAEVSNPPHPLIPIATTRFTGRNYYCWKRQMEFFLNQLRVSYVLFEPCPKIPFSPPASLKDISQAKSYLQQWTNDDYLCRHTILNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026640`
TK1151 ID	TkAUNG080980
OH-1004 ID	LXL04_026640
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026640

Location Chr06:755765-758052 (-)

Description Similar to KELP: RNA polymerase II transcriptional coactivator KELP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10920`	General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026640 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001111 RNA polymerase II promoter clearance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0045899 positive regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process

GO:0051053 negative regulation of DNA metabolic process Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0070062 extracellular exosome Cellular Component

KEGG gene cross-reference

ath:AT4G10920

hsa:10923

mcf:101926874

pon:100173565

spo:2542309

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.747

Rank 1 · LXL04_026640 · OH-1004

Cytoplasm0.284

Rank 2 · LXL04_026640 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_026640 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_026640 · OH-1004

Mitochondrion0.022

Rank 5 · LXL04_026640 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08766.17DEK_C9-60 aa

PF02229.23PC499-148 aa

PF14223.15Retrotran_gag_2238-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026640	`PF08766.17`	DEK_C	9	60	6.1e-08	33.2
LXL04_026640	`PF02229.23`	PC4	99	148	8e-13	48.4
LXL04_026640	`PF14223.15`	Retrotran_gag_2	238	384	4.7e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65155`	Arabidopsis thaliana	RNA polymerase II transcriptional coactivator KELP	38.994%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card