TkAUNG067050 | RubberDandelionOmics

Gene overview

TkAUNG067050

Reference: TK1151 Chr: ChrUn Coordinates: 19459415-19460526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · TkAUNG067050|TK1151|cDNA

ATGGAGAAATTCCGACAACCCTTGATGGGCCGTTTGATCCTGTTACTGTTTCATTGGATGAGAGCTTTAGAGGGCATGCAAATAGATTTGCCTGACGATGATCCTAGAGTGCAAAGAAACGTCACTGGTTTTGAGCCTGACCAATTTTCAGTTTCCCTTTCTTCTACTTATGATTCTGTATGGATTTCTTGGATTACAGGGGATTTTCAAATTGGTAATAATATAAAGCCACTGAATCCGAAAACTGTTGCAAGTGTGGT...

CDS

Download CDS FASTA

585 bp · TkAUNG067050|TK1151|CDS

ATGGAGAAATTCCGACAACCCTTGATGGGCCGTTTGATCCTGTTACTGTTTCATTGGATGAGAGCTTTAGAGGGCATGCAAATAGATTTGCCTGACGATGATCCTAGAGTGCAAAGAAACGTCACTGGTTTTGAGCCTGACCAATTTTCAGTTTCCCTTTCTTCTACTTATGATTCTGTATGGATTTCTTGGATTACAGGGGATTTTCAAATTGGTAATAATATAAAGCCACTGAATCCGAAAACTGTTGCAAGTGTGGT...

Protein

Download Protein FASTA

194 aa · TkAUNG067050|TK1151|PROTEIN

MEKFRQPLMGRLILLLFHWMRALEGMQIDLPDDDPRVQRNVTGFEPDQFSVSLSSTYDSVWISWITGDFQIGNNIKPLNPKTVASVVYYGKFRFPMFYKATGQSLIYTQLYPFEGLQNYTSGIIHHVRLTGLEPHTVYYYRCGDPSIKAMSDIYYFKTMPVSTSKSYPKNSCYRRPRPHVQLHFNNQAFDNQQT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG067050`
TK1151 ID	TkAUNG067050
OH-1004 ID	LXL04_004042
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.700
Protein coverage (%)	TK1151 76.289 / OH-1004 26.930 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG067050

Location ChrUn:19459415-19460526 (+)

Description Similar to PAP15: Purple acid phosphatase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07130`	Acid phosphatase activity with p-nitrophenyl phosphate (pNPP), D-myoinositol 1-phosphate (Ins(1)P1), phytic acid and Myo- inositol hexakisphosphate.	An Arabidopsis purple acid phosphatase with phytase activity increases foliar ascorbate.2008 · DOI: 10.1104/pp.107.109934
`At2g32770`	Purple acid phosphatase 13.	No verified direct reference in this release
`At4g13700`	Acid phosphatase activity with ATP, ADP, dATP, pyrophosphate, polyphosphate, phosphoserine and phosphothreonine.	Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower.2005 · DOI: 10.1007/s11103-005-0183-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004042 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009845 seed germination Biological Process

GO:0009846 pollen germination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0008707 inositol hexakisphosphate 4-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G32770

ath:AT3G07130

ath:AT3G52810

ath:AT3G52820

ath:AT4G13700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.358

Rank 1 · TkAUNG067050 · TK1151

Extracellular0.239

Rank 2 · TkAUNG067050 · TK1151

Cytoplasm0.183

Rank 3 · TkAUNG067050 · TK1151

Cell membrane0.151

Rank 4 · TkAUNG067050 · TK1151

Endoplasmic reticulum0.140

Rank 5 · TkAUNG067050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16655PhoD_N25-48 aa

PF16656Pur_ac_phosph_N46-158 aa

PF16655PhoD_N121-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG067050	`PF16655`	PhoD_N	25	48	0.0029	18.5
TkAUNG067050	`PF16656`	Pur_ac_phosph_N	46	158	2.9e-16	60.5
TkAUNG067050	`PF16655`	PhoD_N	121	160	0.0029	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFU3`	Arabidopsis thaliana	sp\|Q9SFU3\|PPA15_ARATH Purple acid phosphatase 15	63.900%	Swiss-Prot	High
`O48840`	Arabidopsis thaliana	sp\|O48840\|PPA13_ARATH Purple acid phosphatase 13	53.600%	Swiss-Prot	High
`Q6TPH1`	Arabidopsis thaliana	sp\|Q6TPH1\|PPA23_ARATH Purple acid phosphatase 23	51.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card