LXL04_004042 | RubberDandelionOmics

Gene overview

LXL04_004042

Reference: OH-1004 Chr: Chr01 Coordinates: 123134631-123137031 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · LXL04_004042|LXL04_004042|OH1004|cDNA

ATGGTGTTCACGAGAGAGGGATGGGGTCTGAATCTGTTTGGGTTTTATTGTTCTTTGTTAATTTTCGTGGGATTTGTTTTCGGCGGCGAGATCGTTAAAGGTGACGGTGGAATTCCGACCACACTCGACGGACCTTTTACTCCGGTTACGGTGCCACTGGACTATAGTTTTCGTGGGAATGCCGTGGACTTGCCGTCAGACGACCCTCGTGTCCGGAGAACTGCTAACGGGTTTGAACCTGAACAGATATCGATTTCTCT...

CDS

Download CDS FASTA

1674 bp · LXL04_004042|LXL04_004042|OH1004|CDS

ATGGTGTTCACGAGAGAGGGATGGGGTCTGAATCTGTTTGGGTTTTATTGTTCTTTGTTAATTTTCGTGGGATTTGTTTTCGGCGGCGAGATCGTTAAAGGTGACGGTGGAATTCCGACCACACTCGACGGACCTTTTACTCCGGTTACGGTGCCACTGGACTATAGTTTTCGTGGGAATGCCGTGGACTTGCCGTCAGACGACCCTCGTGTCCGGAGAACTGCTAACGGGTTTGAACCTGAACAGATATCGATTTCTCT...

Protein

Download Protein FASTA

557 aa · LXL04_004042|LXL04_004042|OH1004|PROTEIN

MVFTREGWGLNLFGFYCSLLIFVGFVFGGEIVKGDGGIPTTLDGPFTPVTVPLDYSFRGNAVDLPSDDPRVRRTANGFEPEQISISLSTTHDSVWISWVTGEYQIGYNIKPLDPKSVASVVEYGKVKSMKKQTQKAEGYSLIYNQLYPYKGLQNYTSGIIHHVQLTGLSPDTVYYYRCGDPSIKAMSGIFAFKTMPISGPKNYPKIGIVGDLGLTYNSTSTVNHLIKNRPDLLLLVGDATYANLYLTNGTGSDCYSCSFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004042`
TK1151 ID	TkAUNG067050
OH-1004 ID	LXL04_004042
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.700
Protein coverage (%)	TK1151 76.289 / OH-1004 26.930 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004042

Location Chr01:123134631-123137031 (+)

Description Similar to PAP15: Purple acid phosphatase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07130`	Acid phosphatase activity with p-nitrophenyl phosphate (pNPP), D-myoinositol 1-phosphate (Ins(1)P1), phytic acid and Myo- inositol hexakisphosphate.	An Arabidopsis purple acid phosphatase with phytase activity increases foliar ascorbate.2008 · DOI: 10.1104/pp.107.109934
`At2g32770`	Purple acid phosphatase 13.	No verified direct reference in this release
`At4g13700`	Acid phosphatase activity with ATP, ADP, dATP, pyrophosphate, polyphosphate, phosphoserine and phosphothreonine.	Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower.2005 · DOI: 10.1007/s11103-005-0183-0
`At3g52820`	Purple acid phosphatase 22.	No verified direct reference in this release
`At3g52810`	Purple acid phosphatase 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004042 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009845 seed germination Biological Process

GO:0009846 pollen germination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0008707 inositol hexakisphosphate 4-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G32770

ath:AT3G07130

ath:AT3G52810

ath:AT3G52820

ath:AT4G13700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.278

Rank 1 · LXL04_004042 · OH-1004

Cell membrane0.264

Rank 2 · LXL04_004042 · OH-1004

Extracellular0.227

Rank 3 · LXL04_004042 · OH-1004

Cytoplasm0.116

Rank 4 · LXL04_004042 · OH-1004

Endoplasmic reticulum0.083

Rank 5 · LXL04_004042 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656.12Pur_ac_phosph_N80-194 aa

PF00149.34Metallophos205-417 aa

PF14008.12Metallophos_C474-524 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004042	`PF16656.12`	Pur_ac_phosph_N	80	194	2e-17	64.3
LXL04_004042	`PF00149.34`	Metallophos	205	417	6.7e-20	73.1
LXL04_004042	`PF14008.12`	Metallophos_C	474	524	8.8e-17	62.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFU3`	Arabidopsis thaliana	Purple acid phosphatase 15	70.472%	Swiss-Prot	strong database homology
`O48840`	Arabidopsis thaliana	Purple acid phosphatase 13	53.690%	Swiss-Prot	strong database homology
`Q6TPH1`	Arabidopsis thaliana	Purple acid phosphatase 23	57.432%	Swiss-Prot	strong database homology
`Q8S340`	Arabidopsis thaliana	Purple acid phosphatase 22	39.216%	Swiss-Prot	moderate database homology
`Q9LXI4`	Arabidopsis thaliana	Purple acid phosphatase 21	38.210%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card