TkAUNG041210 | RubberDandelionOmics

Gene overview

TkAUNG041210

Reference: TK1151 Chr: ChrUn Coordinates: 11466811-11468121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · TkAUNG041210|TK1151|cDNA

ATGCAGGAGAAACAGCTCTACCACAAAGTTCTATCCTATCTCAATTCGTTACCATCAACTGCGGATTCCGATTTCGTCAATCTTCAACACATTCATAAAGTCGCGGAGGAGATCGAGCTAAAGAGTAACGAAGTCAGGCTATACATCAACGCGGAAACCGAACCAGAGAAGAATGGGAGATGGAAATCGATTCCGTTCACACATCCGACGACGATCGACACCGCAATGATCGATTCCGAGTTTAAAACCAAGGTGAAGTC...

CDS

Download CDS FASTA

1311 bp · TkAUNG041210|TK1151|CDS

ATGCAGGAGAAACAGCTCTACCACAAAGTTCTATCCTATCTCAATTCGTTACCATCAACTGCGGATTCCGATTTCGTCAATCTTCAACACATTCATAAAGTCGCGGAGGAGATCGAGCTAAAGAGTAACGAAGTCAGGCTATACATCAACGCGGAAACCGAACCAGAGAAGAATGGGAGATGGAAATCGATTCCGTTCACACATCCGACGACGATCGACACCGCAATGATCGATTCCGAGTTTAAAACCAAGGTGAAGTC...

Protein

Download Protein FASTA

436 aa · TkAUNG041210|TK1151|PROTEIN

MQEKQLYHKVLSYLNSLPSTADSDFVNLQHIHKVAEEIELKSNEVRLYINAETEPEKNGRWKSIPFTHPTTIDTAMIDSEFKTKVKSDLEQFLKSKQYYHRLGRVWKRSYLLYGQSGTGKSSFIAGMAKFLCYDLYDVDMSKVTRDSDLKLLLLQTTSKSMIVVEDLDKYLFEKEKSTAVSLSGILNFMDGIISCCGEERIMVFTVSNKDQIDPTVLRPGGIDVHIHFPLCDFSSFKNLANSHLGIKEHKLFPQVEEIFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG041210`
TK1151 ID	TkAUNG041210
OH-1004 ID	LXL04_003148
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 97.706 / OH-1004 81.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG041210

Location ChrUn:11466811-11468121 (+)

Description Similar to At2g46620: AAA-ATPase At2g46620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46620`	AAA-ATPase At2g46620.	No verified direct reference in this release
`At5g17760`	AAA-ATPase At5g17760.	No verified direct reference in this release
`At4g25835`	AAA-ATPase At4g25835.	No verified direct reference in this release
`At5g17730`	AAA-ATPase At5g17730.	No verified direct reference in this release
`At3g28580`	AAA-ATPase At3g28580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006950 response to stress Biological Process

GO:0009411 response to UV Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G46620

ath:AT3G28580

ath:AT3G50930

ath:AT4G25835

ath:AT5G17760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkAUNG041210 · TK1151

Nucleus0.299

Rank 2 · TkAUNG041210 · TK1151

Mitochondrion0.123

Rank 3 · TkAUNG041210 · TK1151

Cell membrane0.093

Rank 4 · TkAUNG041210 · TK1151

Plastid0.092

Rank 5 · TkAUNG041210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05673DUF81556-209 aa

PF27113GbsR_C74-105 aa

PF13191AAA_1699-132 aa

PF12775AAA_7107-159 aa

PF03193RsgA_GTPase107-127 aa

PF13479AAA_24108-135 aa

PF13555AAA_29108-132 aa

PF13401AAA_22108-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG041210	`PF05673`	DUF815	56	209	5.7e-05	23.1
TkAUNG041210	`PF27113`	GbsR_C	74	105	0.068	14.4
TkAUNG041210	`PF13191`	AAA_16	99	132	0.022	16.0
TkAUNG041210	`PF12775`	AAA_7	107	159	0.072	13.3
TkAUNG041210	`PF03193`	RsgA_GTPase	107	127	0.15	12.6
TkAUNG041210	`PF13479`	AAA_24	108	135	0.003	18.0
TkAUNG041210	`PF13555`	AAA_29	108	132	0.012	16.1
TkAUNG041210	`PF13401`	AAA_22	108	145	0.18	12.8
TkAUNG041210	`PF00004`	AAA	110	230	2.4e-10	41.7
TkAUNG041210	`PF07728`	AAA_5	111	150	0.015	16.1
TkAUNG041210	`PF27394`	Aq_aa27	111	178	0.076	13.6
TkAUNG041210	`PF00910`	RNA_helicase	111	168	0.11	13.7
TkAUNG041210	`PF25568`	AAA_lid_At3g28540	231	296	1.8e-11	44.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IJ77`	Arabidopsis thaliana	sp\|F4IJ77\|AATP4_ARATH AAA-ATPase At2g46620	54.900%	Swiss-Prot	Medium
`Q9FN75`	Arabidopsis thaliana	sp\|Q9FN75\|AATPI_ARATH AAA-ATPase At5g17760	40.600%	Swiss-Prot	Medium
`Q8RY66`	Arabidopsis thaliana	sp\|Q8RY66\|AATPD_ARATH AAA-ATPase At4g25835	38.100%	Swiss-Prot	Medium
`Q9FN78`	Arabidopsis thaliana	sp\|Q9FN78\|AATPF_ARATH AAA-ATPase At5g17730	39.900%	Swiss-Prot	Medium
`Q9LJJ7`	Arabidopsis thaliana	sp\|Q9LJJ7\|AATP9_ARATH AAA-ATPase At3g28580	36.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card