LXL04_003148 | RubberDandelionOmics

Gene overview

LXL04_003148

Reference: OH-1004 Chr: Chr01 Coordinates: 69247915-69249707 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · LXL04_003148|LXL04_003148|OH1004|cDNA

ATGCAGGAGAAACAGCTCTACCACAAAGTTCTATCCTATCTCAATTCGTTACCATCAGCTGCGGATTCCGATTTCGTCAATCTTCAACACATTCATAAAGTCGCGGAGGAGATCGAGCTAAAGAGTAACGAAGTCAGGCTATACATCAACGCGGAAACCGAACCAGAGAAGAATGGGAGATGGAAATCGATTCCGTTCACACATCCGGCGACGATCGACACCGCAATGATCGATTCCGAGTTTAAAACCAAGGTGAAGTC...

CDS

Download CDS FASTA

1533 bp · LXL04_003148|LXL04_003148|OH1004|CDS

ATGCAGGAGAAACAGCTCTACCACAAAGTTCTATCCTATCTCAATTCGTTACCATCAGCTGCGGATTCCGATTTCGTCAATCTTCAACACATTCATAAAGTCGCGGAGGAGATCGAGCTAAAGAGTAACGAAGTCAGGCTATACATCAACGCGGAAACCGAACCAGAGAAGAATGGGAGATGGAAATCGATTCCGTTCACACATCCGGCGACGATCGACACCGCAATGATCGATTCCGAGTTTAAAACCAAGGTGAAGTC...

Protein

Download Protein FASTA

510 aa · LXL04_003148|LXL04_003148|OH1004|PROTEIN

MQEKQLYHKVLSYLNSLPSAADSDFVNLQHIHKVAEEIELKSNEVRLYINAETEPEKNGRWKSIPFTHPATIDTAMIDSEFKTKVKSDLEQFLKSKQYYHRLGRVWKRSYLLYGQSGTGKSSFIAGMPKFLCYDLYDVDMSKVTGDSDLKLLLLQTTSKSMIVVEDLDKYLFEKEKSTAVSLSGILNFMDGIISCCGEERIMVFTVSNKDQIDPTVLRPGRIDVHIHFPLCDFSSFKNLANSHLGIKEHKLFPQVEEIFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003148`
TK1151 ID	TkAUNG041210
OH-1004 ID	LXL04_003148
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 97.706 / OH-1004 81.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003148

Location Chr01:69247915-69249707 (+)

Description Similar to At2g46620: AAA-ATPase At2g46620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46620`	AAA-ATPase At2g46620.	No verified direct reference in this release
`At5g17760`	AAA-ATPase At5g17760.	No verified direct reference in this release
`At3g50930`	Protein HYPER-SENSITIVITY-RELATED 4.	No verified direct reference in this release
`At4g25835`	AAA-ATPase At4g25835.	No verified direct reference in this release
`At3g28580`	AAA-ATPase At3g28580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003148 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006950 response to stress Biological Process

GO:0009411 response to UV Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G46620

ath:AT3G28580

ath:AT3G50930

ath:AT4G25835

ath:AT5G17760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · LXL04_003148 · OH-1004

Nucleus0.301

Rank 2 · LXL04_003148 · OH-1004

Mitochondrion0.120

Rank 3 · LXL04_003148 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_003148 · OH-1004

Cell membrane0.101

Rank 5 · LXL04_003148 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA110-230 aa

PF25568.1AAA_lid_At3g28540231-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003148	`PF00004.36`	AAA	110	230	1.3e-10	42.5
LXL04_003148	`PF25568.1`	AAA_lid_At3g28540	231	296	3.3e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IJ77`	Arabidopsis thaliana	AAA-ATPase At2g46620	65.957%	Swiss-Prot	moderate database homology
`Q9FN75`	Arabidopsis thaliana	AAA-ATPase At5g17760	40.239%	Swiss-Prot	weak database homology
`Q8VZG2`	Arabidopsis thaliana	Protein HYPER-SENSITIVITY-RELATED 4	42.918%	Swiss-Prot	weak database homology
`Q8RY66`	Arabidopsis thaliana	AAA-ATPase At4g25835	38.127%	Swiss-Prot	moderate database homology
`Q9LJJ7`	Arabidopsis thaliana	AAA-ATPase At3g28580	37.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card