TkAUNG001360 | RubberDandelionOmics

Gene overview

TkAUNG001360

Reference: TK1151 Chr: ChrUn Coordinates: 347360-355395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2648 bp · TkAUNG001360|TK1151|cDNA

TATATGAAAGTCTTCCTTTAAAGATCCAATCATGTTTTGAACATTAAGTAACAAGAAAGACCATTTCAGTTTTGCTTGCGGGAATCTAACAGGGAATCTACCAATATCTTTATAATTCAGCATTAAAGCAACAAGTATCAAGTTCATCGAAAAATCTATAAATAACTTTAAACAAACTCCATAATATCTAAAAAAAATCACAAAACCATCAAGTCCTATATACCTATGTTTTACAGCTTTCAATCCCTATTTATTACCCA...

CDS

Download CDS FASTA

1869 bp · TkAUNG001360|TK1151|CDS

CAGAAGTATATAAGTTTTGGCGGGAACGCTTGGGAATTTTGGGGCCGTTTCGCGGCAGACCAGACTAACCTTTGCAACTGGACGACAACAACGAGGATGCTGCGTATCAAATCAGAGCCTATTGAAAATTCGCCGGAGATTAAATCAACGGCTATCAAAGTCCCGCCGGATATCAAATCAGAGGCCATTGAATTCCCACCGGATGTTAAATCAGGGAGCATAGAATACACCCAGGAGATCCCTCCGACCAAGCGTCTCAA...

Protein

Download Protein FASTA

622 aa · TkAUNG001360|TK1151|PROTEIN

QKYISFGGNAWEFWGRFAADQTNLCNWTTTTRMLRIKSEPIENSPEIKSTAIKVPPDIKSEAIEFPPDVKSGSIEYTQEIPPTKRLKTLSPSSPSPSPSPSPSPSPSPSSKGKSKVVKEEDEDDSLWEQQLDTCGVCLLEEGMSRRGFIDSCDHYFCFVCIMEWAKVESRCPICKRRFSTIHRPQDGVFLSERVVNVPVRDQVYCHNGNATLGPSDPYSQVKCTICSLSSDDHLLLLCDLCDSAAHSYCVGLGATVPEGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG001360`
TK1151 ID	TkAUNG001360
OH-1004 ID	LXL04_008742
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.300
Protein coverage (%)	TK1151 96.624 / OH-1004 93.641 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG001360`
Location	ChrUn:347360-355395 (+)
Description	Similar to Phrf1: PHD and RING finger domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008742` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006366 transcription by RNA polymerase II Biological Process GO:0006397 mRNA processing Biological Process GO:0006914 autophagy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0019904 protein domain specific binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function GO:0070063 RNA polymerase binding Molecular Function
KEGG gene cross-reference	hsa:57661 mmu:101471 ppa:PAS_chr1-1_0041 spo:2539058 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkAUNG001360 · TK1151

Cytoplasm0.100

Rank 2 · TkAUNG001360 · TK1151

Cell membrane0.031

Rank 3 · TkAUNG001360 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkAUNG001360 · TK1151

Plastid0.011

Rank 5 · TkAUNG001360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639zf-RING_2132-175 aa

PF13920zf-C3HC4_3132-179 aa

PF00097zf-C3HC4134-174 aa

PF13923zf-C3HC4_2134-174 aa

PF14634zf-RING_5134-176 aa

PF16685zf-RING_10134-177 aa

PF14447Prok-RING_4137-179 aa

PF30092SLX5_C140-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG001360	`PF13639`	zf-RING_2	132	175	3.6e-07	31.0
TkAUNG001360	`PF13920`	zf-C3HC4_3	132	179	0.0012	19.4
TkAUNG001360	`PF00097`	zf-C3HC4	134	174	0.00012	22.5
TkAUNG001360	`PF13923`	zf-C3HC4_2	134	174	0.00063	20.2
TkAUNG001360	`PF14634`	zf-RING_5	134	176	0.0016	19.1
TkAUNG001360	`PF16685`	zf-RING_10	134	177	0.011	16.5
TkAUNG001360	`PF14447`	Prok-RING_4	137	179	0.012	16.3
TkAUNG001360	`PF30092`	SLX5_C	140	181	0.027	15.3
TkAUNG001360	`PF03854`	zf-P11	146	178	0.0028	18.0
TkAUNG001360	`PF12678`	zf-rbx1	149	175	0.0042	18.0
TkAUNG001360	`PF13445`	zf-RING_UBOX	151	172	5.1	7.9
TkAUNG001360	`PF13445`	zf-RING_UBOX	171	179	5.1	7.9
TkAUNG001360	`PF13920`	zf-C3HC4_3	220	238	0.0012	19.4
TkAUNG001360	`PF14634`	zf-RING_5	220	226	0.0016	19.1
TkAUNG001360	`PF13831`	PHD_2	221	226	1.2	9.4
TkAUNG001360	`PF13639`	zf-RING_2	222	250	3.6e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card