LXL04_008742 | RubberDandelionOmics

Gene overview

LXL04_008742

Reference: OH-1004 Chr: Chr02 Coordinates: 107591398-107595232 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1890 bp · LXL04_008742|LXL04_008742|OH1004|cDNA

ATGGAAATGGAGGCGTCGGAAGAAGAAGCGGTGACGATGTGCTCCGCAGTGAGGTCCCACAGGATGGGGGTGGTTATCGTTGTTTGGTTGGGGCTCGAAATGGGATTAGAATTCAGAACCAGTAACCTTTGCAACTGGACGACAACAACGAGGATGCTGCCTATCAAATCAGAGCCTATTGAAAATTCGCCGGAGATTAAAGTCCCGCCGGATATCAAATCAGAGGCCATTGAATTCCCACCTGATGTTAAATCACAGAG...

CDS

Download CDS FASTA

1890 bp · LXL04_008742|LXL04_008742|OH1004|CDS

ATGGAAATGGAGGCGTCGGAAGAAGAAGCGGTGACGATGTGCTCCGCAGTGAGGTCCCACAGGATGGGGGTGGTTATCGTTGTTTGGTTGGGGCTCGAAATGGGATTAGAATTCAGAACCAGTAACCTTTGCAACTGGACGACAACAACGAGGATGCTGCCTATCAAATCAGAGCCTATTGAAAATTCGCCGGAGATTAAAGTCCCGCCGGATATCAAATCAGAGGCCATTGAATTCCCACCTGATGTTAAATCACAGAG...

Protein

Download Protein FASTA

629 aa · LXL04_008742|LXL04_008742|OH1004|PROTEIN

MEMEASEEEAVTMCSAVRSHRMGVVIVVWLGLEMGLEFRTSNLCNWTTTTRMLPIKSEPIENSPEIKVPPDIKSEAIEFPPDVKSQSIEYTQEIPPTKRLKTLSPSSPSPSPSPSPSSKGKSKVVKEEDDDSLWEQQLDTCGVCLLEEGMSRRGFIDSCDHYFCFVCIMEWAKVESRCPICKRRFSTIHRPQDGVFLSERVVNVPVRDQVYCHNGNATLGPSDPYSQVKCTICSLSSDDHLLLLCDLCDSAAHSYCVGLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008742`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_008742`
Location	Chr02:107591398-107595232 (-)
Description	Similar to Phrf1: PHD and RING finger domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008742` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006366 transcription by RNA polymerase II Biological Process GO:0006397 mRNA processing Biological Process GO:0006914 autophagy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0019904 protein domain specific binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function GO:0070063 RNA polymerase binding Molecular Function
KEGG gene cross-reference	hsa:57661 mmu:101471 ppa:PAS_chr1-1_0041 spo:2539058 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · LXL04_008742 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_008742 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_008742 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_008742 · OH-1004

Plastid0.011

Rank 5 · LXL04_008742 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2139-182 aa

PF00628.36PHD230-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008742	`PF13639.13`	zf-RING_2	139	182	3.7e-07	31.0
LXL04_008742	`PF00628.36`	PHD	230	273	5.7e-08	33.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card