TkA08G415580 | RubberDandelionOmics

Gene overview

TkA08G415580

Reference: TK1151 Chr: Chr08 Coordinates: 105710359-105712468 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1746 bp · TkA08G415580|TK1151|cDNA

AATGGACTAGGTGGGTCCCGCGTCTACTTTTGCGACTGTACTATTCGAATTTTCAGCGATACTTGCAAGGTTTAAACATTGACCACCGGAAGTTGTTGACAAATGAGTTGCCTTATATACAACTGAACGCGGTAGTTGGCAGAAACAAACGTTCATGGCTTTTCCAAATTGGGTATTAGTTATAACAGAGTTTTATATTCTTACACATCTTGCTGGTCTCACCTTTACCCATGGAGACTATCAATGCGGAAACCAAGAAC...

CDS

Download CDS FASTA

822 bp · TkA08G415580|TK1151|CDS

ATGGTAGTGATGAGGAGTAGTTTCTATGGATACTCATGTTTGTTAAAATACGAAATATTAGTTTTCAGCACTGCGAATCCTCCAAACCCAACCCAACCATTTAATCCGCCTCAAGGGAAGAATAGATCCAAGGTGGTCGTTCCAGCAGTAACGGTGGCAGCAGTAATATTCGCGATCTTGATCCTCTTTTTTTGCTTAATGGTCCGCAGAATTTATACTCAAAAAGGGGAAGAGGAAGAACTTTTTGAAGCATCAGATGA...

Protein

Download Protein FASTA

273 aa · TkA08G415580|TK1151|PROTEIN

MVVMRSSFYGYSCLLKYEILVFSTANPPNPTQPFNPPQGKNRSKVVVPAVTVAAVIFAILILFFCLMVRRIYTQKGEEEELFEASDDDNGEMIYFRLKAVQAATRNFSGANKLGEGGFGPVYWGILRDGKKIAVKRLSQYSGQGMQEFKTEVKLIIKLQHKNLVKLLGCCMKGKERLLVYEYMSNSSLDYYLFEDPIKGKELDWAKRANIVNGIAKGLRYLHEDSRLKIIHRDLKASNILLDEEMNPKISDFGTARIFGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G415580`
TK1151 ID	TkA08G415580
OH-1004 ID	LXL04_034635
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.800
Protein coverage (%)	TK1151 97.436 / OH-1004 40.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G415580

Location Chr08:105710359-105712468 (-)

Description Similar to CRK14: Cysteine-rich receptor-like protein kinase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11340`	G-type lectin S-receptor-like serine/threonine-protein kinase RKS1.	No verified direct reference in this release
`At4g27300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1.	No verified direct reference in this release
`At4g11900`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900.	No verified direct reference in this release
`At1g11410`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410.	No verified direct reference in this release
`At4g23270`	Cysteine-rich receptor-like protein kinase 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034635 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G05200

ath:AT4G21230

ath:AT4G23180

ath:AT4G23200

ath:AT4G23220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.822

Rank 1 · TkA08G415580 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA08G415580 · TK1151

Cytoplasm0.090

Rank 3 · TkA08G415580 · TK1151

Nucleus0.057

Rank 4 · TkA08G415580 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA08G415580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06365CD34_antigen43-81 aa

PF17591UL41A44-89 aa

PF21314TM_ErbB149-70 aa

PF00069Pkinase56-86 aa

PF00069Pkinase110-272 aa

PF07714PK_Tyr_Ser-Thr111-261 aa

PF03109ABC1117-137 aa

PF03109ABC1176-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G415580	`PF06365`	CD34_antigen	43	81	0.29	11.8
TkA08G415580	`PF17591`	UL41A	44	89	0.076	13.8
TkA08G415580	`PF21314`	TM_ErbB1	49	70	0.45	11.0
TkA08G415580	`PF00069`	Pkinase	56	86	7.6e-34	118.0
TkA08G415580	`PF00069`	Pkinase	110	272	7.6e-34	118.0
TkA08G415580	`PF07714`	PK_Tyr_Ser-Thr	111	261	1.3e-34	120.4
TkA08G415580	`PF03109`	ABC1	117	137	0.0065	16.4
TkA08G415580	`PF03109`	ABC1	176	260	0.0065	16.4
TkA08G415580	`PF06293`	Kdo	179	245	0.12	12.5
TkA08G415580	`PF12330`	Haspin_kinase	204	262	0.016	15.0
TkA08G415580	`PF01636`	APH	218	256	0.15	12.5
TkA08G415580	`PF19974`	TCAD9	218	254	0.25	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT07`	Arabidopsis thaliana	sp\|Q9ZT07\|RKS1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RKS1	63.500%	Swiss-Prot	High
`O81833`	Arabidopsis thaliana	sp\|O81833\|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	53.000%	Swiss-Prot	High
`Q9T058`	Arabidopsis thaliana	sp\|Q9T058\|Y4119_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900	52.600%	Swiss-Prot	High
`Q9LPZ3`	Arabidopsis thaliana	sp\|Q9LPZ3\|Y1141_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410	60.300%	Swiss-Prot	High
`Q8GWJ7`	Arabidopsis thaliana	sp\|Q8GWJ7\|CRK19_ARATH Cysteine-rich receptor-like protein kinase 19	49.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card