TkA08G413640 | RubberDandelionOmics

Gene overview

TkA08G413640

Reference: TK1151 Chr: Chr08 Coordinates: 105300306-105300851 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA08G413640|TK1151|cDNA

ATGAATCTAAGTTCAAATTCAACAGGATTGCACACTCTATTAAGTTCCCCTTTCATGGATCACATACTCTATTTTCTTCAGGATGTTGACATCTCCATTCAAGAATCATCTTTAAAAGCTGCATTTTGGTTAAGTGGAATTTCCGATGATTTCAAGAAAGCTATGGGAGATAAAGAGTTCATGCAAGAACTTGTCAAATTGATAGCCGCAAAGTCGTTTGAAGTTCGAGAAATGGCATCCGAGACCTTATCGAATTTAGT...

CDS

Download CDS FASTA

483 bp · TkA08G413640|TK1151|CDS

ATGAATCTAAGTTCAAATTCAACAGGATTGCACACTCTATTAAGTTCCCCTTTCATGGATCACATACTCTATTTTCTTCAGGATGTTGACATCTCCATTCAAGAATCATCTTTAAAAGCTGCATTTTGGTTAAGTGGAATTTCCGATGATTTCAAGAAAGCTATGGGAGATAAAGAGTTCATGCAAGAACTTGTCAAATTGATAGCCGCAAAGTCGTTTGAAGTTCGAGAAATGGCATCCGAGACCTTATCGAATTTAGT...

Protein

Download Protein FASTA

160 aa · TkA08G413640|TK1151|PROTEIN

MNLSSNSTGLHTLLSSPFMDHILYFLQDVDISIQESSLKAAFWLSGISDDFKKAMGDKEFMQELVKLIAAKSFEVREMASETLSNLVSIPKNRRKFVENDQNVTLIMQSIGCNSGRKKILSSGYLKNIEKLADEQVSDARKIVRNLSSNRFVRMIRGFWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G413640`
TK1151 ID	TkA08G413640
OH-1004 ID	LXL04_010135
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.300
Protein coverage (%)	TK1151 73.750 / OH-1004 22.973 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G413640`
Location	Chr08:105300306-105300851 (+)
Description	Similar to PUB4: U-box domain-containing protein 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010135` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000011 vacuole inheritance Biological Process GO:0000045 autophagosome assembly Biological Process GO:0000425 pexophagy Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006914 autophagy Biological Process GO:0016236 macroautophagy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031503 protein-containing complex localization Biological Process GO:0034497 protein localization to phagophore assembly site Biological Process GO:0034517 ribophagy Biological Process GO:0034614 cellular response to reactive oxygen species Biological Process GO:0034727 piecemeal microautophagy of the nucleus Biological Process
KEGG gene cross-reference	ago:AGOS_AEL048W ath:AT2G23140 ath:AT5G67340 cgr:2891501 sce:YEL013W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · TkA08G413640 · TK1151

Nucleus0.356

Rank 2 · TkA08G413640 · TK1151

Cell membrane0.135

Rank 3 · TkA08G413640 · TK1151

Mitochondrion0.102

Rank 4 · TkA08G413640 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA08G413640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24768ARM_ARMC53-114 aa

PF25786HEAT_GCN1_C11-99 aa

PF00514Arm18-37 aa

PF02985HEAT19-40 aa

PF18185STALD32-75 aa

PF25598ARM_PUB35-119 aa

PF00514Arm49-88 aa

PF25151TPR_Trm732_C54-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G413640	`PF24768`	ARM_ARMC5	3	114	0.0023	18.1
TkA08G413640	`PF25786`	HEAT_GCN1_C	11	99	0.042	14.6
TkA08G413640	`PF00514`	Arm	18	37	0.00041	21.0
TkA08G413640	`PF02985`	HEAT	19	40	0.014	16.3
TkA08G413640	`PF18185`	STALD	32	75	0.11	12.7
TkA08G413640	`PF25598`	ARM_PUB	35	119	0.0091	16.1
TkA08G413640	`PF00514`	Arm	49	88	0.00041	21.0
TkA08G413640	`PF25151`	TPR_Trm732_C	54	94	0.0051	17.4
TkA08G413640	`PF02985`	HEAT	61	88	0.014	16.3
TkA08G413640	`PF28867`	T26G10_4	75	141	0.091	13.6
TkA08G413640	`PF18185`	STALD	103	148	0.11	12.7
TkA08G413640	`PF25786`	HEAT_GCN1_C	118	152	0.042	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card