Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1557 bp · LXL04_010135|LXL04_010135|OH1004|cDNA
ATGGTAGAAGAGAAAGCCGACCTCGCTGGAACAAACGCCGGAAGTTTAAGACTCCGGCAAGCCACGGATCAAATCTCTTCGCTAATCTTCCTCTCTCACTCCACCAAAGTCTTCTCATCAAAATGGAAACTGATAAGAAGCAAGCTAGACGAGATTCTCTCTATACTCGCCTCTCTCCCTCCGGAACTTCAAGCTTCCGCCGACAACAACCCAACTCTCTCCGGCATCATGCGGTCCATTGAAGAAACAACAGATTGTTC...
1557 bp · LXL04_010135|LXL04_010135|OH1004|CDS
ATGGTAGAAGAGAAAGCCGACCTCGCTGGAACAAACGCCGGAAGTTTAAGACTCCGGCAAGCCACGGATCAAATCTCTTCGCTAATCTTCCTCTCTCACTCCACCAAAGTCTTCTCATCAAAATGGAAACTGATAAGAAGCAAGCTAGACGAGATTCTCTCTATACTCGCCTCTCTCCCTCCGGAACTTCAAGCTTCCGCCGACAACAACCCAACTCTCTCCGGCATCATGCGGTCCATTGAAGAAACAACAGATTGTTC...
Protein
Download Protein FASTA518 aa · LXL04_010135|LXL04_010135|OH1004|PROTEIN
MVEEKADLAGTNAGSLRLRQATDQISSLIFLSHSTKVFSSKWKLIRSKLDEILSILASLPPELQASADNNPTLSGIMRSIEETTDCSTSLAQKCIEHSYTGKLLMQSDLDIIFVKFENNVKSLSEFINSEGLLSNGNYAIVVSRPAPAASRDDIQFYVKDLLCRFKIGRIEMKKQALASFNEVIQEDERYVKIAMEIEGLVHILMKFLNSKDIEIQEEALKSVATICGFDSYKTVLVGTGIISPLIRVLESGSDLGKELS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010135 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010135 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:140827114-140828728 (-) | |||||||||
| Description | Similar to PUB4: U-box domain-containing protein 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000011 vacuole inheritance Biological Process GO:0000045 autophagosome assembly Biological Process GO:0000425 pexophagy Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006914 autophagy Biological Process GO:0016236 macroautophagy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031503 protein-containing complex localization Biological Process GO:0034497 protein localization to phagophore assembly site Biological Process GO:0034517 ribophagy Biological Process GO:0034614 cellular response to reactive oxygen species Biological Process GO:0034727 piecemeal microautophagy of the nucleus Biological Process | |||||||||
| KEGG gene cross-reference | ago:AGOS_AEL048W ath:AT2G23140 ath:AT5G67340 cgr:2891501 sce:YEL013W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23005.2DUF703220-129 aaPF24768.2ARM_ARMC5172-289 aaPF24768.2ARM_ARMC5270-480 aaPF25598.2ARM_PUB273-486 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010135 | PF23005.2 | DUF7032 | 20 | 129 | 6.2e-29 | 100.8 |
| LXL04_010135 | PF24768.2 | ARM_ARMC5 | 172 | 289 | 7.4e-17 | 62.4 |
| LXL04_010135 | PF24768.2 | ARM_ARMC5 | 270 | 480 | 7.4e-17 | 62.4 |
| LXL04_010135 | PF25598.2 | ARM_PUB | 273 | 486 | 5.9e-10 | 39.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.