RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G194780
Reference: TK1151 Chr: Chr08 Coordinates: 50886873-50891667 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3084 bp · TkA08G194780|TK1151|cDNA

CAACAATCATCAGCTCAATTAGGCATTATTATTTGATTCGCAGATCTTGCAAAGCGATTATGTACAGCAGCAGAACTTCGAGTATACTTCACGAGTTTTATAAACAAAGTCGATGATTCCGCTAAAAGCATTTCGCAAGCTCATTTCCTGGACCCTAACAGAAACTGTAATCTGACATCATGGACCAGTGGATGCGAGCCAGGATGGGCTAGCGCCGTCAATCCTGGCCAGAAATATGAATTCAACGAAACAAATCCACG...

CDS

Download CDS FASTA

3240 bp · TkA08G194780|TK1151|CDS

ATGCACGAGAAAATGAATGGAGAGAAAAAGACAATCACCTCTTCGGTTGGATGTTTGATCCTCATTCTGGTTTTTTCCGGTTATTTTCCACGATGCGTTTGGTGTCAAGACGACCCCGATGATCCTCCTGTGAACAATAAACGACCTAGGATTTCACCATTGTTTTCGAATTTCCTTTCTCAACAATTCAACAAGTCGATTAGGAAATACAAGGCTTCAATTAAAAGAACCCTACACTATTGCACTGAAGATGTGGACAA...

Protein

Download Protein FASTA

1079 aa · TkA08G194780|TK1151|PROTEIN

MHEKMNGEKKTITSSVGCLILILVFSGYFPRCVWCQDDPDDPPVNNKRPRISPLFSNFLSQQFNKSIRKYKASIKRTLHYCTEDVDKDISGAFNFEGKDEFFTNCQVKFKDLAKRLCTAAELRVYFTSFINKVDDSAKSISQAHFLDPNRNCNLTSWTSGCEPGWASAVNPGQKYEFNETNPRKIPFRTDNSQPCCEGFFCPQGLTCMIPCPLGAYCPVAKLDKKSGICDPYHYQQPAGKPNYTCGSADMWGPVQMGSDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G194780
TK1151 IDTkA08G194780
OH-1004 IDLXL04_032660
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 97.913
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G194780
LocationChr08:50886873-50891667 (-)
DescriptionSimilar to WBC30: Putative white-brown complex homolog protein 30
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60740 ABC transporter G family member 28. No verified direct reference in this release
At2g37010 Putative white-brown complex homolog protein 30. No verified direct reference in this release
At1g53390 ABC transporter G family member 24. No verified direct reference in this release
At1g31770 Positive regulator of plant growth which acts as an efflux pump involved in the major root-to-shoot (acropetal) long-distance cytokinin (CK) transport via the xylem sap.
ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334
Arabidopsis ABCG14 protein controls the acropetal translocation of root-synthesized cytokinins.2014 · DOI: 10.1038/ncomms4274
Arabidopsis ABCG14 is essential for the root-to-shoot translocation of cytokinin.2014 · DOI: 10.1073/pnas.1321519111
Cytokinin Response Factor 6 Represses Cytokinin-Associated Genes during Oxidative Stress.2016 · DOI: 10.1104/pp.16.00415
A Role of Cytokinin Transporter in Arabidopsis Immunity.2017 · DOI: 10.1094/mpmi-01-17-0011-r

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B9G5Y5 ABC transporter G family member 25. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032660 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000082 G1/S transition of mitotic cell cycle Biological Process
GO:0000266 mitochondrial fission Biological Process
GO:0001666 response to hypoxia Biological Process
GO:0001708 cell fate specification Biological Process
GO:0001894 tissue homeostasis Biological Process
GO:0006473 protein acetylation Biological Process
GO:0006568 L-tryptophan metabolic process Biological Process
GO:0006778 porphyrin-containing compound metabolic process Biological Process
GO:0006783 heme biosynthetic process Biological Process
GO:0006869 lipid transport Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007005 mitochondrion organization Biological Process
KEGG gene cross-reference
ath:AT1G53390
ath:AT2G37010
ath:AT5G60740
dosa:Os10g0442900
rno:312382
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.794
Rank 1 · TkA08G194780 · TK1151
Cytoplasm0.136
Rank 2 · TkA08G194780 · TK1151
Endoplasmic reticulum0.085
Rank 3 · TkA08G194780 · TK1151
Lysosome / Vacuole0.052
Rank 4 · TkA08G194780 · TK1151
Golgi apparatus0.047
Rank 5 · TkA08G194780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09534Trp_oprn_chp303-364 aa
PF16038TMIE305-381 aa
PF01956EMC3_TMCO1308-481 aa
PF11364DUF3165312-326 aa
PF28933CRE9315-471 aa
PF13304AAA_21360-409 aa
PF13476AAA_23363-472 aa
PF00005ABC_tran370-370 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G194780PF09534Trp_oprn_chp3033640.02815.0
TkA08G194780PF16038TMIE3053810.06113.8
TkA08G194780PF01956EMC3_TMCO13084810.8710.1
TkA08G194780PF11364DUF31653123268.27.7
TkA08G194780PF28933CRE93154710.0414.8
TkA08G194780PF13304AAA_213604090.0004121.1
TkA08G194780PF13476AAA_233634720.1113.9
TkA08G194780PF00005ABC_tran3703701.2e-2488.2
TkA08G194780PF19055ABC2_membrane_73823823.2e-177590.2
TkA08G194780PF00485PRK4284850.006317.1
TkA08G194780PF13604AAA_305075460.09413.2
TkA08G194780PF02463SMC_N5116820.05313.7
TkA08G194780PF00005ABC_tran5156661.2e-2488.2
TkA08G194780PF03193RsgA_GTPase5165480.009416.5
TkA08G194780PF13481AAA_255165490.03714.4
TkA08G194780PF13401AAA_225255480.6111.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FF46Arabidopsis thalianasp|Q9FF46|AB28G_ARATH ABC transporter G family member 2855.000%Swiss-ProtHigh
Q9SJK6Arabidopsis thalianasp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 3054.600%Swiss-ProtHigh
Q9MAG3Arabidopsis thalianasp|Q9MAG3|AB24G_ARATH ABC transporter G family member 2451.500%Swiss-ProtHigh
Q9C6W5Arabidopsis thalianasp|Q9C6W5|AB14G_ARATH ABC transporter G family member 1445.900%Swiss-ProtLow
B9G5Y5Oryza sativa subsp. japonicasp|B9G5Y5|AB25G_ORYSJ ABC transporter G family member 2546.600%Swiss-ProtMedium

JBrowse

View in Genome Browser