LXL04_032660 | RubberDandelionOmics

Gene overview

LXL04_032660

Reference: OH-1004 Chr: Chr07 Coordinates: 27338526-27343022 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3309 bp · LXL04_032660|LXL04_032660|OH1004|cDNA

ATGGGTTCATCATCATCGTCATCACCTCAAGGCTTATCCCCAATCCCCGGCCACGTCCTAAAACCTAACATGCACGAGAAAATGAATGGAGAGAAAAAGACAATCACCTCTTCGGTTGGATGTTTGATCCTCATTCTGGTTTTTTCCGGTTATTTTCCACGATGCGTTTGGTGTCAAGACGACCCCGATGATCCTCCTGTGAACAATAAACGACCTAGGATTTCACCATTGTTTTCGAATTTCCTTTCTCAACAATTCAA...

CDS

Download CDS FASTA

3309 bp · LXL04_032660|LXL04_032660|OH1004|CDS

ATGGGTTCATCATCATCGTCATCACCTCAAGGCTTATCCCCAATCCCCGGCCACGTCCTAAAACCTAACATGCACGAGAAAATGAATGGAGAGAAAAAGACAATCACCTCTTCGGTTGGATGTTTGATCCTCATTCTGGTTTTTTCCGGTTATTTTCCACGATGCGTTTGGTGTCAAGACGACCCCGATGATCCTCCTGTGAACAATAAACGACCTAGGATTTCACCATTGTTTTCGAATTTCCTTTCTCAACAATTCAA...

Protein

Download Protein FASTA

1102 aa · LXL04_032660|LXL04_032660|OH1004|PROTEIN

MGSSSSSSPQGLSPIPGHVLKPNMHEKMNGEKKTITSSVGCLILILVFSGYFPRCVWCQDDPDDPPVNNKRPRISPLFSNFLSQQFNKSIRKYKASIKRTLHYCTEDVDKDISGAFNFEGKDEFFTNCQVKFKDLAKRLCTAAELRVYFTSFINKVDDSAKSISQAHFLDPNRNCNLTSWTSGCEPGWASAVNPGQKYEFNETNPRKIPFRTDNSQPCCEGFFCPQGLTCMIPCPLGAYCPVAKLDKKSGICDPYHYQQP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032660`
TK1151 ID	TkA08G194780
OH-1004 ID	LXL04_032660
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 97.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032660

Location Chr07:27338526-27343022 (-)

Description Similar to WBC30: Putative white-brown complex homolog protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37010`	Putative white-brown complex homolog protein 30.	No verified direct reference in this release
`At5g60740`	ABC transporter G family member 28.	No verified direct reference in this release
`At1g53390`	ABC transporter G family member 24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B9G5Y5`	ABC transporter G family member 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032660 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0000266 mitochondrial fission Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0001708 cell fate specification Biological Process

GO:0001894 tissue homeostasis Biological Process

GO:0006473 protein acetylation Biological Process

GO:0006568 L-tryptophan metabolic process Biological Process

GO:0006778 porphyrin-containing compound metabolic process Biological Process

GO:0006783 heme biosynthetic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007005 mitochondrion organization Biological Process

KEGG gene cross-reference

ath:AT1G53390

ath:AT2G37010

ath:AT5G60740

dosa:Os10g0442900

rno:312382

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785

Rank 1 · LXL04_032660 · OH-1004

Cytoplasm0.132

Rank 2 · LXL04_032660 · OH-1004

Endoplasmic reticulum0.088

Rank 3 · LXL04_032660 · OH-1004

Lysosome / Vacuole0.056

Rank 4 · LXL04_032660 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_032660 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran538-689 aa

PF19055.7ABC2_membrane_7718-1102 aa

PF01061.30ABC2_membrane855-1019 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032660	`PF00005.34`	ABC_tran	538	689	1.3e-24	88.1
LXL04_032660	`PF19055.7`	ABC2_membrane_7	718	1102	7.5e-177	589.0
LXL04_032660	`PF01061.30`	ABC2_membrane	855	1019	5.7e-08	33.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJK6`	Arabidopsis thaliana	Putative white-brown complex homolog protein 30	57.051%	Swiss-Prot	strong database homology
`Q9FF46`	Arabidopsis thaliana	ABC transporter G family member 28	55.636%	Swiss-Prot	strong database homology
`Q9MAG3`	Arabidopsis thaliana	ABC transporter G family member 24	52.302%	Swiss-Prot	strong database homology
`B9G5Y5`	Oryza sativa subsp. japonica	ABC transporter G family member 25	47.047%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card