RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G169330
Reference: TK1151 Chr: Chr08 Coordinates: 44297160-44298770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1189 bp · TkA08G169330|TK1151|cDNA

AGTGAACCTGGCCGGTTAAAACCATGGAAACACGGAGAATATTCGTCACACAAGAGATCCCTCATCGAATATACCCCTTGATTGTTCCAAAATCCACTATTTCTTCATATATTTTATCAATCAAACCCATTGTCAATGCTCTAATTCTCTTTCTGTATATATATCTGTGAACAGACGTGATTCACAGCAAAACATTCATATTCTCGTTGAAATCGGTCCGAATTTCGACTTGTTTTATTGTCAAACAAGATGCAGTTCTA...

CDS

Download CDS FASTA

873 bp · TkA08G169330|TK1151|CDS

ATGCAGTTCTATAAGCTTCTGAAGAAATTGATCGACGAGATGTTTCCGGATTGGAGAGATAAGTTTCTCTCATATAAGGATCTTAAGAAGCTATTGAAGCGGGTTTACTCTAGAGACGGTCGCTGTAATAAAAGAATGAAATTGAGCAGCGGTGACGCGATTGAGACGATGGCGGAAGAGAAGGAGGTTGTGGATTTCGTGAAATTGTGCCAGGAGCAGACCGATAAGCTTAATGATTTTGTTTTGGAAAAACAAGAGTG...

Protein

Download Protein FASTA

290 aa · TkA08G169330|TK1151|PROTEIN

MQFYKLLKKLIDEMFPDWRDKFLSYKDLKKLLKRVYSRDGRCNKRMKLSSGDAIETMAEEKEVVDFVKLCQEQTDKLNDFVLEKQEWYIIKVEVLEGNLIAAKDSRQELMKVARDLADLHGEIILLLNYSALNYTGLVKILKKHDKLSGALVRVPFIQKVLNEPFYKTDVLNNLVKKCEMMLDKISPMKEQTSSTSESIIMNEGRSSETLTEPNESSSVRVPDDLVEIENRENKYLKLTLSALTVLAEIRGGSSTINMFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G169330
TK1151 IDTkA08G169330
OH-1004 IDLXL04_032359
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G169330
LocationChr08:44297160-44298770 (+)
DescriptionSimilar to SPX2: SPX domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g26660 May inhibit PHR1 DNA-binding activity in a Pi-dependent manner.
SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis.2014 · DOI: 10.1073/pnas.1404654111
At5g20150 Plays a positive role in plant adaptation to phosphate starvation.
Characterization of a sub-family of Arabidopsis genes with the SPX domain reveals their diverse functions in plant tolerance to phosphorus starvation.2008 · DOI: 10.1111/j.1365-313x.2008.03460.x
SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis.2014 · DOI: 10.1073/pnas.1404654111

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0603600 Involved in plant adaptation to phosphate (Pi) starvation.
Involvement of OsSPX1 in phosphate homeostasis in rice.2009 · DOI: 10.1111/j.1365-313x.2008.03734.x
Regulation of OsSPX1 and OsSPX3 on expression of OsSPX domain genes and Pi-starvation signaling in rice.2009 · DOI: 10.1111/j.1744-7909.2009.00834.x
OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice.2010 · DOI: 10.1111/j.1365-313x.2010.04170.x
Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner.2014 · DOI: 10.1073/pnas.1404680111
An SPX-RLI1 Module Regulates Leaf Inclination in Response to Phosphate Availability in Rice.2018 · DOI: 10.1105/tpc.17.00738
UniProt: B8B4D0 Involved in plant adaptation to phosphate (Pi) starvation (By similarity). No verified direct reference in this release
UniProt: A2X254 Inhibits PHR2 DNA-binding activity via a phosphate (Pi)-dependent protein interaction (By similarity). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032359 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0051511 negative regulation of unidimensional cell growth Biological Process
GO:0070417 cellular response to cold Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0080040 positive regulation of cellular response to phosphate starvation Biological Process
GO:2000024 regulation of leaf development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT2G26660
ath:AT5G20150
dosa:Os02g0202200
dosa:Os06g0603600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.525
Rank 1 · TkA08G169330 · TK1151
Cytoplasm0.421
Rank 2 · TkA08G169330 · TK1151
Cell membrane0.184
Rank 3 · TkA08G169330 · TK1151
Endoplasmic reticulum0.052
Rank 4 · TkA08G169330 · TK1151
Lysosome / Vacuole0.044
Rank 5 · TkA08G169330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105SPX8-37 aa
PF30927DUF876143-86 aa
PF15874Il2rg44-96 aa
PF03105SPX50-112 aa
PF15874Il2rg115-128 aa
PF03105SPX117-160 aa
PF15874Il2rg202-236 aa
PF03105SPX205-214 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G169330PF03105SPX8372.1e-1558.3
TkA08G169330PF30927DUF876143860.002818.2
TkA08G169330PF15874Il2rg44960.113.6
TkA08G169330PF03105SPX501122.1e-1558.3
TkA08G169330PF15874Il2rg1151280.113.6
TkA08G169330PF03105SPX1171602.1e-1558.3
TkA08G169330PF15874Il2rg2022360.113.6
TkA08G169330PF03105SPX2052142.1e-1558.3
TkA08G169330PF30927DUF87612112490.002818.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O48781Arabidopsis thalianasp|O48781|SPX2_ARATH SPX domain-containing protein 247.200%Swiss-ProtMedium
Q8LBH4Arabidopsis thalianasp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 143.000%Swiss-ProtMedium
Q69XJ0Oryza sativa subsp. japonicasp|Q69XJ0|SPX1_ORYSJ SPX domain-containing protein 144.000%Swiss-ProtMedium
B8B4D0Oryza sativa subsp. indicasp|B8B4D0|SPX1_ORYSI SPX domain-containing protein 144.000%Swiss-ProtMedium
A2X254Oryza sativa subsp. indicasp|A2X254|SPX2_ORYSI SPX domain-containing protein 240.700%Swiss-ProtMedium

JBrowse

View in Genome Browser