TkA08G142240 | RubberDandelionOmics

Gene overview

TkA08G142240

Reference: TK1151 Chr: Chr08 Coordinates: 37089161-37093633 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · TkA08G142240|TK1151|cDNA

GAAAAACTAAAAGTGAAAATGAATGACTAGGGCCTTAGAATCCGCACCCTTTATAATCTCTCAAAGTCTGCCGGCAGAGCTTACCGTTTCGTTCGTTTCTTTGATTTTGTAGCAGCAGCAGACAGTTTGATTCGAAGATCCATCAACAGAAAACATGGCAGCAGTTGAAGAGCCTGTTGCTCCAGTCGAGGTACCAGCCCCTGCTGCTCTTGGTGAGCCCATGGACATAATGACAGCTTTGCAACTCGTGCTAAGAAAGT...

CDS

Download CDS FASTA

750 bp · TkA08G142240|TK1151|CDS

ATGCCGGTCGGCGTTCTTGCTCTACAGGGTTCCTTCAATGAACACATCGCCGCTCTAAGGAGGATTGGAGTGAAGGGAGTGGAGATAAGGAAAGCGGAACAGTTGGAGAACGTGAGCTCACTCATTATCCCCGGCGGCGAAAGCACCACCATGGCTAAGCTCGCCGAACTGCACAATCTGTTTCCTGCTCTCCGTGAGTTTGTAAAAATGGGGAAACCAGTTTGGGGAACATGCGCTGGTCTCATCTTCTTGGCAAACAA...

Protein

Download Protein FASTA

249 aa · TkA08G142240|TK1151|PROTEIN

MPVGVLALQGSFNEHIAALRRIGVKGVEIRKAEQLENVSSLIIPGGESTTMAKLAELHNLFPALREFVKMGKPVWGTCAGLIFLANKATGQKEGGQELVGGLDCTVHRNFFGSQIQSFEAEVPVPDLVAKEGGPPSFRAVFIRAPAILEVGPDVEVLASVTIKSTKIVDPSQEGEPDSQVIVAVKQGNLLATAFHPELTIDSRWHSYFMKMSGGNNEIVAASSSSRSFYGDEESYLYNKQPKTDLPVYE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G142240`
TK1151 ID	TkA08G142240
OH-1004 ID	LXL04_032022
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G142240

Location Chr08:37089161-37093633 (-)

Description Similar to PDX2: Probable pyridoxal 5'-phosphate synthase subunit PDX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60540`	Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate.	Vitamin B6 biosynthesis in higher plants.2005 · DOI: 10.1073/pnas.0506228102 Functional analysis of PDX2 from Arabidopsis, a glutaminase involved in vitamin B6 biosynthesis.2007 · DOI: 10.1104/pp.107.096784
`At1g15930`	Small ribosomal subunit protein eS12z.	No verified direct reference in this release
`At2g32060`	Small ribosomal subunit protein eS12y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032022 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006543 L-glutamine catabolic process Biological Process

GO:0008614 pyridoxine metabolic process Biological Process

GO:0042819 vitamin B6 biosynthetic process Biological Process

GO:0042823 pyridoxal phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:1903600 glutaminase complex Cellular Component

GO:0004359 glutaminase activity Molecular Function

GO:0036381 pyridoxal 5'-phosphate synthase (glutamine hydrolysing) activity Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G60540

bcl:ABC0452

det:DET0598

mta:Moth_0010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA08G142240 · TK1151

Nucleus0.379

Rank 2 · TkA08G142240 · TK1151

Mitochondrion0.094

Rank 3 · TkA08G142240 · TK1151

Cell membrane0.088

Rank 4 · TkA08G142240 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA08G142240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01174SNO5-211 aa

PF07685GATase_315-105 aa

PF00117GATase30-105 aa

PF03575Peptidase_S5133-90 aa

PF09825BPL_N36-88 aa

PF01965DJ-1_PfpI37-88 aa

PF09825BPL_N140-201 aa

PF07685GATase_3182-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G142240	`PF01174`	SNO	5	211	4.3e-52	177.4
TkA08G142240	`PF07685`	GATase_3	15	105	2.5e-09	37.7
TkA08G142240	`PF00117`	GATase	30	105	0.0015	19.0
TkA08G142240	`PF03575`	Peptidase_S51	33	90	0.0003	21.3
TkA08G142240	`PF09825`	BPL_N	36	88	5.1e-06	26.3
TkA08G142240	`PF01965`	DJ-1_PfpI	37	88	0.0016	19.0
TkA08G142240	`PF09825`	BPL_N	140	201	5.1e-06	26.3
TkA08G142240	`PF07685`	GATase_3	182	195	2.5e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAD0`	Arabidopsis thaliana	sp\|Q8LAD0\|PDX2_ARATH Probable pyridoxal 5'-phosphate synthase subunit PDX2	69.900%	Swiss-Prot	High
`Q9S9P1`	Arabidopsis thaliana	sp\|Q9S9P1\|RS121_ARATH Small ribosomal subunit protein eS12z	73.900%	Swiss-Prot	High
`Q9SKZ3`	Arabidopsis thaliana	sp\|Q9SKZ3\|RS122_ARATH Small ribosomal subunit protein eS12y	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card