LXL04_032022 | RubberDandelionOmics

Gene overview

LXL04_032022

Reference: OH-1004 Chr: Chr07 Coordinates: 15101631-15102868 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

723 bp · LXL04_032022|LXL04_032022|OH1004|cDNA

ATGCCGGTCGGCGTTCTTGCTCTACAGGGTTCCTTCAATGAACACATCGCCGCTCTAAGGAGGATTGGAGTGAAGGGAGTGGAGATAAGGAAAGCGGAACAGTTGGAGAACGTGAGCTCACTCATTATCCCCGGCGGCGAAAGCACCACCATGGCTAAGCTCGCCGAACTGCACAATCTGTTTCCTGCTCTCCGTGAGTTTGTAAAAATGGGGAAACCAGTTTGGGGAACATGCGCTGGTCTCATCTTCTTGGCAAACAA...

CDS

Download CDS FASTA

723 bp · LXL04_032022|LXL04_032022|OH1004|CDS

ATGCCGGTCGGCGTTCTTGCTCTACAGGGTTCCTTCAATGAACACATCGCCGCTCTAAGGAGGATTGGAGTGAAGGGAGTGGAGATAAGGAAAGCGGAACAGTTGGAGAACGTGAGCTCACTCATTATCCCCGGCGGCGAAAGCACCACCATGGCTAAGCTCGCCGAACTGCACAATCTGTTTCCTGCTCTCCGTGAGTTTGTAAAAATGGGGAAACCAGTTTGGGGAACATGCGCTGGTCTCATCTTCTTGGCAAACAA...

Protein

Download Protein FASTA

240 aa · LXL04_032022|LXL04_032022|OH1004|PROTEIN

MPVGVLALQGSFNEHIAALRRIGVKGVEIRKAEQLENVSSLIIPGGESTTMAKLAELHNLFPALREFVKMGKPVWGTCAGLIFLANKATGQKEGGQELVGGLDCTIQSFEAEVPVPDLVAKEGGPPSFRAVFIRAPAILEVGPDVEVLASVTIKSTKIVDPSQEGEPDSQVIVAVKQGNLLATAFHPELTIDSRWHSYFMKMSGGNNEIVAASSSSSSFYGDEESYLYNKQPKTDLPVYE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032022`
TK1151 ID	TkA08G142240
OH-1004 ID	LXL04_032022
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032022

Location Chr07:15101631-15102868 (-)

Description Similar to PDX2: Probable pyridoxal 5'-phosphate synthase subunit PDX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60540`	Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate.	Vitamin B6 biosynthesis in higher plants.2005 · DOI: 10.1073/pnas.0506228102 Functional analysis of PDX2 from Arabidopsis, a glutaminase involved in vitamin B6 biosynthesis.2007 · DOI: 10.1104/pp.107.096784

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032022 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006543 L-glutamine catabolic process Biological Process

GO:0008614 pyridoxine metabolic process Biological Process

GO:0042819 vitamin B6 biosynthetic process Biological Process

GO:0042823 pyridoxal phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:1903600 glutaminase complex Cellular Component

GO:0004359 glutaminase activity Molecular Function

GO:0036381 pyridoxal 5'-phosphate synthase (glutamine hydrolysing) activity Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G60540

bcl:ABC0452

det:DET0598

mta:Moth_0010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.652

Rank 1 · LXL04_032022 · OH-1004

Nucleus0.363

Rank 2 · LXL04_032022 · OH-1004

Cell membrane0.088

Rank 3 · LXL04_032022 · OH-1004

Mitochondrion0.076

Rank 4 · LXL04_032022 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_032022 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01174.26SNO5-202 aa

PF07685.21GATase_315-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032022	`PF01174.26`	SNO	5	202	2.3e-43	149.0
LXL04_032022	`PF07685.21`	GATase_3	15	105	2.4e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAD0`	Arabidopsis thaliana	Probable pyridoxal 5'-phosphate synthase subunit PDX2	66.406%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card