Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3444 bp · TkA08G139960|TK1151|cDNA
AAAAATTCCTCGAGGTTTTCACCTTTTGATCCATCGTCCACATAATCCCTGTTCTGAGTTCTCTCAAATTCGATTCAGTATCCGTTTGGATGTTAATCGGCATTTATTATGTCTAGATTTTGATAATAATACGCCTCAGTTTTGATTTCGATTGGTTTTATTTGTGATTTCGTTTTCCGGTTTTGTGTGTTTAAGTTCGTTGATCAATCCAGCGGAGTCTGCGTTCAGATCTTAAGTAGTTATCAACTTATCATGGCACA...
927 bp · TkA08G139960|TK1151|CDS
ATGGCACAAGCTGCGGCAACTTCAGGGTGGCTCAGAGGAAGAGTGAAAGCTGTTCCATCTGGCGATTCCTTGGTGATTATGGGATTTACCAAAGCTGAAATCCCCCCAGAGAAGACTATTGTTTTGGCTCATCTTACATCCCCGAGATTAGCCCGTAGAGGCGGCACTGATGATCCATTCGCATGGGAAAGCAGAGAATTCTTACGAAAGTTGTGTGTAGGAAAGGACGTTGTTTTCAAAACGGAATACACAATCCCAAA...
Protein
Download Protein FASTA308 aa · TkA08G139960|TK1151|PROTEIN
MAQAAATSGWLRGRVKAVPSGDSLVIMGFTKAEIPPEKTIVLAHLTSPRLARRGGTDDPFAWESREFLRKLCVGKDVVFKTEYTIPNFSREFCSLFIGTTNISKEVVTHGWAKVNKAKGEVTPEHAELLRLEEQARQQGVGLWNRSPGATAAAIRNLPPSAVGDPSNLDAMGLLASNKGRPMEAIVEQVRDGSSLRVYLLPEFQFVQVFVAGIQAPSMGRRTTIEPAAITEIPSEELNGDTNSEIRGPLTSAQRVTVSPT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G139960 |
|---|---|
| TK1151 ID | TkA08G139960 |
| OH-1004 ID | LXL04_009260 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 67.500 |
| Protein coverage (%) | TK1151 99.026 / OH-1004 37.674Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G139960 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:36387450-36392893 (-) | |||||||||
| Description | Similar to TSN1: Ribonuclease TUDOR 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006397 mRNA processing Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0009651 response to salt stress Biological Process GO:0009686 gibberellin biosynthetic process Biological Process GO:0009845 seed germination Biological Process GO:0010372 positive regulation of gibberellin biosynthetic process Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0034605 cellular response to heat Biological Process GO:0046686 response to cadmium ion Biological Process GO:0000932 P-body Cellular Component GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G07350 ath:AT5G61780 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00565SNase39-144 aaPF00565SNase265-306 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G139960 | PF00565 | SNase | 39 | 144 | 8e-22 | 78.4 |
| TkA08G139960 | PF00565 | SNase | 265 | 306 | 8e-22 | 78.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.