LXL04_009260 | RubberDandelionOmics

Gene overview

LXL04_009260

Reference: OH-1004 Chr: Chr02 Coordinates: 121482221-121487182 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3021 bp · LXL04_009260|LXL04_009260|OH1004|cDNA

ATGTTTGATGTCTTTTATTTTTTCAGATCTTTAAGGATGGCGCAACCAGCTGGAAATTCAGGATGGCTGAGAGGAAGAGTAAAAGCTGTTATGTCTGGCGATACCTTGGTGATTATGGGATTCACCAAAGCTGAAATCCCCCCAGAGAAGACTATCGTTTTAGCTCATCTTTCGGCTCCAAGATTAGCTCGTAGAGGTGGCCAAGATGACCCATTTGCATGGGAAAGCCGAGAATTTCTTCGGAAATTATGTATAGGAAA...

CDS

Download CDS FASTA

3021 bp · LXL04_009260|LXL04_009260|OH1004|CDS

ATGTTTGATGTCTTTTATTTTTTCAGATCTTTAAGGATGGCGCAACCAGCTGGAAATTCAGGATGGCTGAGAGGAAGAGTAAAAGCTGTTATGTCTGGCGATACCTTGGTGATTATGGGATTCACCAAAGCTGAAATCCCCCCAGAGAAGACTATCGTTTTAGCTCATCTTTCGGCTCCAAGATTAGCTCGTAGAGGTGGCCAAGATGACCCATTTGCATGGGAAAGCCGAGAATTTCTTCGGAAATTATGTATAGGAAA...

Protein

Download Protein FASTA

1006 aa · LXL04_009260|LXL04_009260|OH1004|PROTEIN

MFDVFYFFRSLRMAQPAGNSGWLRGRVKAVMSGDTLVIMGFTKAEIPPEKTIVLAHLSAPRLARRGGQDDPFAWESREFLRKLCIGKLRLSGPSPTSKAPTKHLGLRTESDIRGKFLGLRLYWADRVRGKRSDRVRGPSPTDIIKRTDHGPSPWSESESVDVVFRTEYTIPNFSREFCSVFIGSSNVGNEVVTHGWAKVKEGKGEITPDHTELLRLEEQAKQGGVGLWDRSPGAVEAAIRHLPPSAVGDPSNLDAMGLLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009260`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009260

Location Chr02:121482221-121487182 (+)

Description Similar to TSN1: Ribonuclease TUDOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07350`	Cytoprotective ribonuclease (RNase) required for resistance to abiotic stresses, acting as a positive regulator of mRNA decapping during stress.	The RNA binding protein Tudor-SN is essential for stress tolerance and stabilizes levels of stress-responsive mRNAs encoding secreted proteins in Arabidopsis.2010 · DOI: 10.1105/tpc.109.070680 Tudor-SN, a component of stress granules, regulates growth under salt stress by modulating GA20ox3 mRNA levels in Arabidopsis.2014 · DOI: 10.1093/jxb/eru334
`At5g61780`	Cytoprotective ribonuclease (RNase) required for resistance to abiotic stresses, acting as a positive regulator of mRNA decapping during stress.	The RNA binding protein Tudor-SN is essential for stress tolerance and stabilizes levels of stress-responsive mRNAs encoding secreted proteins in Arabidopsis.2010 · DOI: 10.1105/tpc.109.070680

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009260 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006402 mRNA catabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009845 seed germination Biological Process

GO:0010372 positive regulation of gibberellin biosynthetic process Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

ath:AT5G07350

ath:AT5G61780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.732

Rank 1 · LXL04_009260 · OH-1004

Nucleus0.288

Rank 2 · LXL04_009260 · OH-1004

Peroxisome0.127

Rank 3 · LXL04_009260 · OH-1004

Mitochondrion0.090

Rank 4 · LXL04_009260 · OH-1004

Endoplasmic reticulum0.063

Rank 5 · LXL04_009260 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00565.24SNase166-229 aa

PF00565.24SNase353-444 aa

PF00565.24SNase490-631 aa

PF00567.31TUDOR746-870 aa

PF00565.24SNase877-982 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009260	`PF00565.24`	SNase	166	229	6.3e-44	149.5
LXL04_009260	`PF00565.24`	SNase	353	444	6.3e-44	149.5
LXL04_009260	`PF00565.24`	SNase	490	631	6.3e-44	149.5
LXL04_009260	`PF00567.31`	TUDOR	746	870	3.9e-22	79.3
LXL04_009260	`PF00565.24`	SNase	877	982	6.3e-44	149.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG7`	Arabidopsis thaliana	Ribonuclease TUDOR 1	66.667%	Swiss-Prot	moderate database homology
`Q9FLT0`	Arabidopsis thaliana	Ribonuclease TUDOR 2	64.634%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card