TkA08G133140 | RubberDandelionOmics

Gene overview

TkA08G133140

Reference: TK1151 Chr: Chr08 Coordinates: 34597225-34599141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

934 bp · TkA08G133140|TK1151|cDNA

TATATCGGCTTATTCCAGCCGCCAACTTTTGCACCGGCTTATTCCAGCCGCCAACTTTTGCACTGGTTTATTTAAGCCGATATGTGGAACTTCATTCTGCCTACGCTGTTTCCCCTTTTTTGTCTCTATTCCGGTCTATTTTACGGCGATTCCTTCCTGTTTGTCCCTTCCTCTGCTCCCCTTCAACACGCGTCCTCAGCTCCTATCTGCATTTGCTTCGTGTCCTCCTCTCCTTAGACGTCGCGTTCCACCTCCTGAGT...

CDS

Download CDS FASTA

459 bp · TkA08G133140|TK1151|CDS

ATGATCAAGGAGCGTGGAAAGATTCACCTTGTGCTAGAATACTACAAAGGAGGTGATCTATCTATGTTCATTCAAAGGCGTCAAGGTAGAATCCCCAAATCAACATCCCTGCATCTTATACAGCAATTAGGATGTGGTCTGAAAGTTCTTCGTGATAATCAAATCATCCATAGAGATCTAAAACCACAGAATCTCCTACTTTCTTCAAATGAAGACAATTCAACTTTAAAAATTGCAGATTTTTTGTTTTGCAATTCTTT...

Protein

Download Protein FASTA

152 aa · TkA08G133140|TK1151|PROTEIN

MIKERGKIHLVLEYYKGGDLSMFIQRRQGRIPKSTSLHLIQQLGCGLKVLRDNQIIHRDLKPQNLLLSSNEDNSTLKIADFLFCNSLQPRGLAETLCGSPLYMAPEIMQLHNYDAKADLWSVGAILSQLVTGRTPFIGNNQIQVYIYYHRMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G133140`
TK1151 ID	TkA08G133140
OH-1004 ID	LXL04_033058
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.100
Protein coverage (%)	TK1151 100.000 / OH-1004 90.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G133140

Location Chr08:34597225-34599141 (+)

Description Similar to ATG1C: Serine/threonine-protein kinase ATG1c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37840`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g53930`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g61960`	Serine/threonine protein kinase involved in autophagy in a nutritional condition-dependent manner.	The ATG1/ATG13 protein kinase complex is both a regulator and a target of autophagic recycling in Arabidopsis.2011 · DOI: 10.1105/tpc.111.090993
`At1g49180`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033058 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0006914 autophagy Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0042594 response to starvation Biological Process

GO:0061709 reticulophagy Biological Process

GO:0000407 phagophore assembly site Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005776 autophagosome Cellular Component

KEGG gene cross-reference

ath:AT1G49180

ath:AT2G37840

ath:AT3G53930

ath:AT3G61960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566

Rank 1 · TkA08G133140 · TK1151

Nucleus0.487

Rank 2 · TkA08G133140 · TK1151

Mitochondrion0.107

Rank 3 · TkA08G133140 · TK1151

Cell membrane0.039

Rank 4 · TkA08G133140 · TK1151

Endoplasmic reticulum0.031

Rank 5 · TkA08G133140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-143 aa

PF07714PK_Tyr_Ser-Thr4-148 aa

PF03109ABC110-88 aa

PF06293Kdo19-81 aa

PF10707YrbL-PhoP_reg39-80 aa

PF17667Pkinase_fungal48-119 aa

PF01636APH51-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G133140	`PF00069`	Pkinase	2	143	5.7e-37	128.3
TkA08G133140	`PF07714`	PK_Tyr_Ser-Thr	4	148	2.9e-24	86.5
TkA08G133140	`PF03109`	ABC1	10	88	0.2	11.5
TkA08G133140	`PF06293`	Kdo	19	81	0.016	15.4
TkA08G133140	`PF10707`	YrbL-PhoP_reg	39	80	0.034	14.5
TkA08G133140	`PF17667`	Pkinase_fungal	48	119	0.023	14.1
TkA08G133140	`PF01636`	APH	51	71	0.097	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IRW0`	Arabidopsis thaliana	sp\|F4IRW0\|ATG1C_ARATH Serine/threonine-protein kinase ATG1c	75.700%	Swiss-Prot	High
`F4JBP3`	Arabidopsis thaliana	sp\|F4JBP3\|ATG1B_ARATH Serine/threonine-protein kinase ATG1b	72.900%	Swiss-Prot	High
`Q94C95`	Arabidopsis thaliana	sp\|Q94C95\|ATG1A_ARATH Serine/threonine-protein kinase ATG1a	59.000%	Swiss-Prot	High
`F4I1N8`	Arabidopsis thaliana	sp\|F4I1N8\|ATG1T_ARATH Serine/threonine-protein kinase ATG1t	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card