LXL04_033058 | RubberDandelionOmics

Gene overview

LXL04_033058

Reference: OH-1004 Chr: Chr07 Coordinates: 35201428-35202200 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_033058|LXL04_033058|OH1004|cDNA

ATGTGCATACCTGAATTTCATCAAACTGTTCTTAAAATGATTCATATGGTTGGAATTAGGAGCGTGGAAAGATTCACCTTGTGCTACTACAAAGGAGGTGATCTATCTATGTTCATTCAAAGGCGTCAAGGTAGAATCCCCAAATCAACATCCCTGCATCTTATACAGCAATTAGCTGCTGGTCTGAAAGTTCTTCGTGATAATCAAATCATCCATAGAGATCTAAAACCACAGAATCTCCTACTTTCTTCAAATGAAGA...

CDS

Download CDS FASTA

495 bp · LXL04_033058|LXL04_033058|OH1004|CDS

ATGTGCATACCTGAATTTCATCAAACTGTTCTTAAAATGATTCATATGGTTGGAATTAGGAGCGTGGAAAGATTCACCTTGTGCTACTACAAAGGAGGTGATCTATCTATGTTCATTCAAAGGCGTCAAGGTAGAATCCCCAAATCAACATCCCTGCATCTTATACAGCAATTAGCTGCTGGTCTGAAAGTTCTTCGTGATAATCAAATCATCCATAGAGATCTAAAACCACAGAATCTCCTACTTTCTTCAAATGAAGA...

Protein

Download Protein FASTA

164 aa · LXL04_033058|LXL04_033058|OH1004|PROTEIN

MCIPEFHQTVLKMIHMVGIRSVERFTLCYYKGGDLSMFIQRRQGRIPKSTSLHLIQQLAAGLKVLRDNQIIHRDLKPQNLLLSSNEDNSTLKIADFLSLQPRGLAETLCGSPLYMAPEIMQLHNYDAKADLWSVGAILSQLVTGRTPFIGNNQIQVYIYYHRMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033058`
TK1151 ID	TkA08G133140
OH-1004 ID	LXL04_033058
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.100
Protein coverage (%)	TK1151 100.000 / OH-1004 90.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033058

Location Chr07:35201428-35202200 (-)

Description Similar to ATG1C: Serine/threonine-protein kinase ATG1c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37840`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g53930`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g61960`	Serine/threonine protein kinase involved in autophagy in a nutritional condition-dependent manner.	The ATG1/ATG13 protein kinase complex is both a regulator and a target of autophagic recycling in Arabidopsis.2011 · DOI: 10.1105/tpc.111.090993
`At1g49180`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033058 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0006914 autophagy Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0042594 response to starvation Biological Process

GO:0061709 reticulophagy Biological Process

GO:0000407 phagophore assembly site Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005776 autophagosome Cellular Component

KEGG gene cross-reference

ath:AT1G49180

ath:AT2G37840

ath:AT3G53930

ath:AT3G61960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · LXL04_033058 · OH-1004

Nucleus0.437

Rank 2 · LXL04_033058 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_033058 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_033058 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_033058 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase7-155 aa

PF07714.24PK_Tyr_Ser-Thr7-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033058	`PF00069.32`	Pkinase	7	155	2.1e-31	110.0
LXL04_033058	`PF07714.24`	PK_Tyr_Ser-Thr	7	160	4.2e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IRW0`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1c	67.974%	Swiss-Prot	strong database homology
`F4JBP3`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1b	66.013%	Swiss-Prot	strong database homology
`Q94C95`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1a	59.701%	Swiss-Prot	strong database homology
`F4I1N8`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1t	45.752%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card