TkA08G107870 | RubberDandelionOmics

Gene overview

TkA08G107870

Reference: TK1151 Chr: Chr08 Coordinates: 28062837-28065095 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · TkA08G107870|TK1151|cDNA

CGATTTACTAAAAATACAACTTACAGATCAGATTCGTCGGATCAATTTCTTCAAAACTTTGATTTCTGTCGAACCCAAAACAGAGAATAAGACAAACGCACGGGTTTTCTTGAACAAAGTCTTTCTCATTTCATTCATCATCGCTACAACTTTTTCGTCATTCTCTTCGATTCTACTCGATTTCGAAGAAACAAGATTAAACCCACAAGAATTCCCTCTTAACAATTGAATCATTGGAGTAAATTCGAGACCTTCTTTGT...

CDS

Download CDS FASTA

786 bp · TkA08G107870|TK1151|CDS

ATGGGTTGCGCTGCCAGCAATTCTGCTGATTCCAAAGCCGACCGACTGTCACGGTGGAGCGCCACCGGCATTGTAGGCTTACGCGACGCCAAATTAAAGTCGTTTCCAGATGAAGTTCTCGAGCTAGATAGATCAGTACGGACTCTTGATTTGACACACAACAAATTAGCTGACATTCCAGAAGATATCAGCAGATTATCAAACATGCAGAGGCTGATAATGGCTGATAATATAATCGCGCGTCTTCCAGGGAATATCGG...

Protein

Download Protein FASTA

261 aa · TkA08G107870|TK1151|PROTEIN

MGCAASNSADSKADRLSRWSATGIVGLRDAKLKSFPDEVLELDRSVRTLDLTHNKLADIPEDISRLSNMQRLIMADNIIARLPGNIGKLQSLKLLNLDKNRFTFLPDELGQLVKLERLSISGNQLTTLPDTIGSLRNLLLLNVSNNQLKFLPESIGSCFSLEELQANDNSIEELPPSVCNLVHLKSVCLDRNKVKQMPPNLLKECKTLQNISVHDNPISMDQFQSMEGFEEFEARRKKKFDKKIDANVMMGSKGLDEGVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G107870`
TK1151 ID	TkA08G107870
OH-1004 ID	LXL04_031459
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G107870

Location Chr08:28062837-28065095 (-)

Description Similar to IRL7: Plant intracellular Ras-group-related LRR protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0212200`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`Os10g0456200`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031459 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032495 response to muramyl dipeptide Biological Process

GO:0032496 response to lipopolysaccharide Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0070433 negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway Biological Process

GO:0071356 cellular response to tumor necrosis factor Biological Process

GO:0071638 negative regulation of monocyte chemotactic protein-1 production Biological Process

GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels Biological Process

GO:0005604 basement membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009925 basal plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G30105

dosa:Os03g0212200

dosa:Os10g0456200

hsa:55914

xla:432302

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.643

Rank 1 · TkA08G107870 · TK1151

Nucleus0.261

Rank 2 · TkA08G107870 · TK1151

Cell membrane0.199

Rank 3 · TkA08G107870 · TK1151

Golgi apparatus0.098

Rank 4 · TkA08G107870 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA08G107870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23211LRR_LRWD111-77 aa

PF23598LRR_1425-97 aa

PF13855LRR_827-77 aa

PF08653DASH_Dam131-61 aa

PF25019LRR_R13L1-DRL2139-98 aa

PF24048LRR_NXF1-539-59 aa

PF13516LRR_644-58 aa

PF12799LRR_445-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G107870	`PF23211`	LRR_LRWD1	11	77	7.9e-06	26.4
TkA08G107870	`PF23598`	LRR_14	25	97	1.3e-26	93.9
TkA08G107870	`PF13855`	LRR_8	27	77	1.6e-23	82.9
TkA08G107870	`PF08653`	DASH_Dam1	31	61	0.14	12.7
TkA08G107870	`PF25019`	LRR_R13L1-DRL21	39	98	0.0024	18.5
TkA08G107870	`PF24048`	LRR_NXF1-5	39	59	1.2	9.4
TkA08G107870	`PF13516`	LRR_6	44	58	1.5	9.7
TkA08G107870	`PF12799`	LRR_4	45	82	2.5e-16	60.1
TkA08G107870	`PF00560`	LRR_1	45	66	5.7e-15	52.9
TkA08G107870	`PF24758`	LRR_At5g56370	46	95	0.098	13.0
TkA08G107870	`PF14580`	LRR_9	47	146	0.00038	20.8
TkA08G107870	`PF23286`	LRR_13	49	190	0.00075	20.0
TkA08G107870	`PF13516`	LRR_6	67	77	1.5	9.7
TkA08G107870	`PF13855`	LRR_8	68	125	1.6e-23	82.9
TkA08G107870	`PF12799`	LRR_4	68	104	2.5e-16	60.1
TkA08G107870	`PF00560`	LRR_1	68	89	5.7e-15	52.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9F655`	Oryza sativa subsp. japonica	sp\|B9F655\|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7	76.600%	Swiss-Prot	High
`Q7XDQ7`	Oryza sativa subsp. japonica	sp\|Q7XDQ7\|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8	43.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card