TkA08G105140 | RubberDandelionOmics

Gene overview

TkA08G105140

Reference: TK1151 Chr: Chr08 Coordinates: 27301061-27305200 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2227 bp · TkA08G105140|TK1151|cDNA

AGTCAAGATCAATTCTTATCAACCTTTCACTAACTTACTCATAAACAAGAAGTTAATCGTGGGTTTCATTGGTAAACCCTAGGCGTAGCTAATTTTCCAGAACCCTTTATCCATTCATCTCTAAATAGAACTTCGTAACATTATCTCACAAAGTTACAATTTCAAATCCAATCTGCAAAAGGAAAATAGTTGTTTCTGTCATTTCGATCCATCATGCCTACCGTTAGCGTCGGAAGGGACCTTCTTTACACAGCACTAGG...

CDS

Download CDS FASTA

1614 bp · TkA08G105140|TK1151|CDS

ATGATTAATCTAGTTTTATGTTTGTTCTGCCAGACAACAGAGAAAGCAATTATAAGAAAGGAGAAACACCTGAAAGAAGACGAAGACATTGCTGCGGATGAAGAAATAATCTACAAAATTGACGTCCCTGCCAATCGATATGATTTGCTTTGTCTTGAGGGACTTGTGCAGTCTCTTCGCATTTTTCTTGGTATTGATTCAGTACCAAATTACACACTTTCTGATATTAGTAAGCAATCCATGCTTAAAATGCATGTAAA...

Protein

Download Protein FASTA

537 aa · TkA08G105140|TK1151|PROTEIN

MINLVLCLFCQTTEKAIIRKEKHLKEDEDIAADEEIIYKIDVPANRYDLLCLEGLVQSLRIFLGIDSVPNYTLSDISKQSMLKMHVKPETSVIRPFVVCAVLRGITFNEARYNSFIDLQDKLHQNICRRRTLVAIGTHDLDTIEGPFTYEALPPSEIEFKPLKQVETFRADKLMEFYKSDLKLKKYLHIIEDSPVYPVIYDSKRRVLSLPPIINGAHSAISLKTKNVFIECTATDLTKAKIVLNTMVTMFSVYCERKFEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G105140`
TK1151 ID	TkA08G105140
OH-1004 ID	LXL04_031407
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 97.952 / OH-1004 93.624 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G105140

Location Chr08:27301061-27305200 (-)

Description Similar to At1g72550: Phenylalanine--tRNA ligase beta subunit, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72550`	Phenylalanine--tRNA ligase beta subunit, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006432 phenylalanyl-tRNA aminoacylation Biological Process

GO:0051290 protein heterotetramerization Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009328 phenylalanine-tRNA ligase complex Cellular Component

GO:0016020 membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G72550

dme:Dmel_CG5706

hsa:10056

mmu:23874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.521

Rank 1 · TkA08G105140 · TK1151

Nucleus0.292

Rank 2 · TkA08G105140 · TK1151

Mitochondrion0.212

Rank 3 · TkA08G105140 · TK1151

Cell membrane0.055

Rank 4 · TkA08G105140 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA08G105140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18262PhetRS_B128-64 aa

PF03484B533-51 aa

PF03483B3_4112-241 aa

PF03484B5283-355 aa

PF18262PhetRS_B1316-345 aa

PF17759tRNA_synthFbeta359-483 aa

PF01409tRNA-synt_2d359-486 aa

PF17759tRNA_synthFbeta487-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G105140	`PF18262`	PhetRS_B1	28	64	3.6e-12	47.1
TkA08G105140	`PF03484`	B5	33	51	3.3e-19	69.5
TkA08G105140	`PF03483`	B3_4	112	241	1.3e-13	51.7
TkA08G105140	`PF03484`	B5	283	355	3.3e-19	69.5
TkA08G105140	`PF18262`	PhetRS_B1	316	345	3.6e-12	47.1
TkA08G105140	`PF17759`	tRNA_synthFbeta	359	483	3e-39	135.4
TkA08G105140	`PF01409`	tRNA-synt_2d	359	486	0.011	16.0
TkA08G105140	`PF17759`	tRNA_synthFbeta	487	533	3e-39	135.4
TkA08G105140	`PF01409`	tRNA-synt_2d	506	527	0.011	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGE9`	Arabidopsis thaliana	sp\|Q9SGE9\|SYFB_ARATH Phenylalanine--tRNA ligase beta subunit, cytoplasmic	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card