LXL04_031407 | RubberDandelionOmics

Gene overview

LXL04_031407

Reference: OH-1004 Chr: Chr07 Coordinates: 5490228-5494018 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1791 bp · LXL04_031407|LXL04_031407|OH1004|cDNA

ATGCCTACCGTTAGTGTCGGAAGGGACCTTTTTTACACAGCACTAGGACGCACCTACACACAAGACGAGTTCGAAGAATTGTGCTTTGAATTTGGAATCGAGCTCGATGATGTGACAACAGAGAAAGCAATTATAAGAAAGGAGAAACACCTGAAAGAAGACGAAGACATTGCTGCGGATGAAGAAATAATCTACAAAATTGACGTCCCTGCCAATCGATATGATTTACTTTGTCTTGAGGGACTTGTGCAGTCTCTTCG...

CDS

Download CDS FASTA

1791 bp · LXL04_031407|LXL04_031407|OH1004|CDS

ATGCCTACCGTTAGTGTCGGAAGGGACCTTTTTTACACAGCACTAGGACGCACCTACACACAAGACGAGTTCGAAGAATTGTGCTTTGAATTTGGAATCGAGCTCGATGATGTGACAACAGAGAAAGCAATTATAAGAAAGGAGAAACACCTGAAAGAAGACGAAGACATTGCTGCGGATGAAGAAATAATCTACAAAATTGACGTCCCTGCCAATCGATATGATTTACTTTGTCTTGAGGGACTTGTGCAGTCTCTTCG...

Protein

Download Protein FASTA

596 aa · LXL04_031407|LXL04_031407|OH1004|PROTEIN

MPTVSVGRDLFYTALGRTYTQDEFEELCFEFGIELDDVTTEKAIIRKEKHLKEDEDIAADEEIIYKIDVPANRYDLLCLEGLVQSLRIFLGIDSVPNYTLSDISKQSMLKMHVKPETSVIRPFVVCAVLRGITFNEARYNSFIDLQDKLHQNICRRRTLVAIGTHDLDTIEGPFTYEALPPSEIEFKPLKQVETFRADKLMEFYKSDLKLKKYLHIIEDSPVYPVIYDSKRRVLSLPPIINGAHSAISLKTKNVFIECTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031407`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031407

Location Chr07:5490228-5494018 (-)

Description Similar to At1g72550: Phenylalanine--tRNA ligase beta subunit, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72550`	Phenylalanine--tRNA ligase beta subunit, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031407 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006432 phenylalanyl-tRNA aminoacylation Biological Process

GO:0051290 protein heterotetramerization Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009328 phenylalanine-tRNA ligase complex Cellular Component

GO:0016020 membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G72550

dme:Dmel_CG5706

hsa:10056

mmu:23874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547

Rank 1 · LXL04_031407 · OH-1004

Nucleus0.288

Rank 2 · LXL04_031407 · OH-1004

Mitochondrion0.212

Rank 3 · LXL04_031407 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_031407 · OH-1004

Endoplasmic reticulum0.034

Rank 5 · LXL04_031407 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18262.8PhetRS_B11-91 aa

PF03483.23B3_4139-268 aa

PF03484.22B5310-382 aa

PF17759.7tRNA_synthFbeta386-592 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031407	`PF18262.8`	PhetRS_B1	1	91	4.5e-31	107.6
LXL04_031407	`PF03483.23`	B3_4	139	268	1.6e-13	51.4
LXL04_031407	`PF03484.22`	B5	310	382	2.1e-19	70.1
LXL04_031407	`PF17759.7`	tRNA_synthFbeta	386	592	1.2e-46	159.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGE9`	Arabidopsis thaliana	Phenylalanine--tRNA ligase beta subunit, cytoplasmic	69.818%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card