TkA08G105120 | RubberDandelionOmics

Gene overview

TkA08G105120

Reference: TK1151 Chr: Chr08 Coordinates: 27294810-27297770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA08G105120|TK1151|cDNA

TATAAATAGAGATGAACGATGTACCAATATTTACACAGAATTCTCAATTGAAAAAGTTAATATGAAAATGAAAATTGGGATCGAATCATACAGTCGAGTAAGCAAAGATCATCCTATTGCTTCTTTATAGAGACGCTTAAACTCATACGGAAGAGAGAAATTTTCTGTCTTTCACTCTACGATTGACACCACAATCAAACACCGATCTATTCGTTTTTCTTCCAGTTTGTAACACATCTTCCACTTTTAGGGTTTCACAC...

CDS

Download CDS FASTA

1413 bp · TkA08G105120|TK1151|CDS

ATGGTGAATGAATCTGAAGGCGGTCAACAAGAGAAAGACCTCGTAGGTTCGTATTTCTTGGAGTTATGGAGATCGAAGTCCAAGAGGGCAGCTCTTTCACATACAAAAGACGTTGAAATGATGAAATTAGACGATGAAGGCGAAGAACTAGAAGAAGAGGAGGAGCCCGTTCCCACGGAGCTTGATACTCTCAACAGTTCCGGCGGGTTCTCGATTGTATTACCGAACAAGCTATCGGTTCAGTACCCGAGCGTCAACTT...

Protein

Download Protein FASTA

470 aa · TkA08G105120|TK1151|PROTEIN

MVNESEGGQQEKDLVGSYFLELWRSKSKRAALSHTKDVEMMKLDDEGEELEEEEEPVPTELDTLNSSGGFSIVLPNKLSVQYPSVNLHGHDVGVVQANHPAPVKRLLYYFEIFVKNAGARGQIAIGFTTEGFHMRRQPGWEANSFGYHGDDGLLYRGQGKGEAFGPTYSTGDVVGGGINYTSNEFFFTKNGQVVGTVEKDVKGRLYPTVAVHSQSEEVVVNFGKDPFIFDIKVYEATFRAKQQEVIEKSVIPQTASYGIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G105120`
TK1151 ID	TkA08G105120
OH-1004 ID	LXL04_031405
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 95.957 / OH-1004 95.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G105120

Location Chr08:27294810-27297770 (+)

Description Similar to RANBPM: Ran-binding protein M homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35470`	Ran-binding protein M homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031405 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0034657 GID complex Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G35470

bta:519736

dre:793293

hsa:57610

mmu:74334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.595

Rank 1 · TkA08G105120 · TK1151

Cytoplasm0.514

Rank 2 · TkA08G105120 · TK1151

Mitochondrion0.038

Rank 3 · TkA08G105120 · TK1151

Cell membrane0.034

Rank 4 · TkA08G105120 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA08G105120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10607CTLH19-37 aa

PF26038Dimer_MINDY4_N39-62 aa

PF00622SPRY108-224 aa

PF21051ARMC9_LisH258-278 aa

PF26038Dimer_MINDY4_N258-281 aa

PF30093LisH_UCP007778263-276 aa

PF10607CTLH306-445 aa

PF19964EAD11309-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G105120	`PF10607`	CTLH	19	37	3.4e-22	79.8
TkA08G105120	`PF26038`	Dimer_MINDY4_N	39	62	0.15	13.3
TkA08G105120	`PF00622`	SPRY	108	224	1.1e-20	74.7
TkA08G105120	`PF21051`	ARMC9_LisH	258	278	0.0056	17.5
TkA08G105120	`PF26038`	Dimer_MINDY4_N	258	281	0.15	13.3
TkA08G105120	`PF30093`	LisH_UCP007778	263	276	0.014	15.7
TkA08G105120	`PF10607`	CTLH	306	445	3.4e-22	79.8
TkA08G105120	`PF19964`	EAD11	309	328	0.044	14.5
TkA08G105120	`PF19964`	EAD11	347	380	0.044	14.5
TkA08G105120	`PF21051`	ARMC9_LisH	374	382	0.0056	17.5
TkA08G105120	`PF26038`	Dimer_MINDY4_N	384	444	0.15	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYD7`	Arabidopsis thaliana	sp\|F4HYD7\|RANBM_ARATH Ran-binding protein M homolog	62.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card