LXL04_031405 | RubberDandelionOmics

Gene overview

LXL04_031405

Reference: OH-1004 Chr: Chr07 Coordinates: 5484290-5486563 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1422 bp · LXL04_031405|LXL04_031405|OH1004|cDNA

ATGGTGAATGAATCTGAAGGCGGTCAACAAGAGAAAGACCTCGTAGGTTCGTATTTCTTGGAGTTATGGAGATCGAAGTCCAAGAGGGCAGCTCTTTCACATACAAAAGACGTTGAAATGATGAAATTAGACGATGAAGGCGAAGAACtagaagaagaggaggagccCGTTCCCACGGAGCTTGATACTCTCAACAGTTCCGGCGGGTTCTCGATTGTATTACCGAACAAGCTATCGGTTCAGTACCCGAGCGTCAACTT...

CDS

Download CDS FASTA

1422 bp · LXL04_031405|LXL04_031405|OH1004|CDS

ATGGTGAATGAATCTGAAGGCGGTCAACAAGAGAAAGACCTCGTAGGTTCGTATTTCTTGGAGTTATGGAGATCGAAGTCCAAGAGGGCAGCTCTTTCACATACAAAAGACGTTGAAATGATGAAATTAGACGATGAAGGCGAAGAACTAGAAGAAGAGGAGGAGCCCGTTCCCACGGAGCTTGATACTCTCAACAGTTCCGGCGGGTTCTCGATTGTATTACCGAACAAGCTATCGGTTCAGTACCCGAGCGTCAACTT...

Protein

Download Protein FASTA

473 aa · LXL04_031405|LXL04_031405|OH1004|PROTEIN

MVNESEGGQQEKDLVGSYFLELWRSKSKRAALSHTKDVEMMKLDDEGEELEEEEEPVPTELDTLNSSGGFSIVLPNKLSVQYPSVNLHGHDVGVVQANHPAPVKRLLYYFEIFVKNAGARGQIAIGFTTEGFHMRRQPGWEANSFGYHGDDGLLYRGQGKGEAFGPTYSTGDVVGGGINYTSNEFFFTKNGQVVGTVEKDVKGRLYPTVAVHSQSEEVVVNFGKDPFIFDIKVYEATFRAKQQEVIEKMVIPQTASYGIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031405`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031405

Location Chr07:5484290-5486563 (+)

Description Similar to RANBPM: Ran-binding protein M homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35470`	Ran-binding protein M homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0034657 GID complex Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G35470

bta:519736

dre:793293

hsa:57610

mmu:74334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.576

Rank 1 · LXL04_031405 · OH-1004

Cytoplasm0.534

Rank 2 · LXL04_031405 · OH-1004

Mitochondrion0.037

Rank 3 · LXL04_031405 · OH-1004

Cell membrane0.036

Rank 4 · LXL04_031405 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_031405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00622.37SPRY108-224 aa

PF10607.15CTLH306-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031405	`PF00622.37`	SPRY	108	224	1.1e-20	74.7
LXL04_031405	`PF10607.15`	CTLH	306	445	3.4e-22	79.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYD7`	Arabidopsis thaliana	Ran-binding protein M homolog	60.641%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card