RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G105040
Reference: TK1151 Chr: Chr08 Coordinates: 27272873-27275099 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1578 bp · TkA08G105040|TK1151|cDNA

CGATTTTTGAGTAAGAAGGTTTTCCTGTTGACAAAGTCCCGATCCATGGTTTTGGAGCAGTTTAGCTTCCATTGTGGTGTTTCTGGGAATTCTTCAAAGATGTCATCCTCCGTCTTCTTAATACTGTCACTTTCCATCGTCTCGCTTCTAGTCCCGTCGATCTCTTCGCACGAGTTTAAGGTCAATGGGAAGGTGTTGGTGCTTGATGAATCGAACTTCGAAGCCGCAATTTCTTCCTTCGACTTCATCTTCGTTAGTTT...

CDS

Download CDS FASTA

1344 bp · TkA08G105040|TK1151|CDS

ATGGTTTTGGAGCAGTTTAGCTTCCATTGTGGTGTTTCTGGGAATTCTTCAAAGATGTCATCCTCCGTCTTCTTAATACTGTCACTTTCCATCGTCTCGCTTCTAGTCCCGTCGATCTCTTCGCACGAGTTTAAGGTCAATGGGAAGGTGTTGGTGCTTGATGAATCGAACTTCGAAGCCGCAATTTCTTCCTTCGACTTCATCTTCGTTAGTTTTTATGCCCCATGGTGTGGCCACTGCAAACGTCTTAATCCAGAGTT...

Protein

Download Protein FASTA

447 aa · TkA08G105040|TK1151|PROTEIN

MVLEQFSFHCGVSGNSSKMSSSVFLILSLSIVSLLVPSISSHEFKVNGKVLVLDESNFEAAISSFDFIFVSFYAPWCGHCKRLNPELDKAAPMLSGLKDPIVIAKIDADKYHRIAKKYDIDGFPTLKIFMHGLPTDYYGPRKADKLVRYLKKFVAPDITVLESDSGITEFVDSAGTFFPIFIGFGVDESALSKVSVKFKKNAWFSIAKDFSEKTMTLFDFDKTPALVALHPSFNEQNIFYGPFEEKFVEEFVQQSLLPLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G105040
TK1151 IDTkA08G105040
OH-1004 IDLXL04_031404
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G105040
LocationChr08:27272873-27275099 (-)
DescriptionSimilar to PDIL5-2: Protein disulfide-isomerase 5-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g35620 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. No verified direct reference in this release
At1g21750 Protein disulfide isomerase that associates with RD21A protease for trafficking from the ER through the Golgi to lytic and protein storage vacuoles of endothelial cells in developing seeds.
Arabidopsis protein disulfide isomerase-5 inhibits cysteine proteases during trafficking to vacuoles before programmed cell death of the endothelium in developing seeds.2008 · DOI: 10.1105/tpc.108.058339

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0432500 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. No verified direct reference in this release
Os02g0550300 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031404 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006457 protein folding Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010043 response to zinc ion Biological Process
GO:0034976 response to endoplasmic reticulum stress Biological Process
GO:0043067 regulation of programmed cell death Biological Process
GO:0048316 seed development Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0000326 protein storage vacuole Cellular Component
GO:0000327 lytic vacuole within protein storage vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005788 endoplasmic reticulum lumen Cellular Component
KEGG gene cross-reference
ath:AT1G21750
ath:AT1G35620
dosa:Os02g0550300
dosa:Os04g0432500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.794
Rank 1 · TkA08G105040 · TK1151
Golgi apparatus0.128
Rank 2 · TkA08G105040 · TK1151
Nucleus0.094
Rank 3 · TkA08G105040 · TK1151
Cytoplasm0.092
Rank 4 · TkA08G105040 · TK1151
Cell membrane0.045
Rank 5 · TkA08G105040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05296TAS2R17-68 aa
PF00085Thioredoxin50-152 aa
PF20207PedC-like53-132 aa
PF13098Thioredoxin_267-152 aa
PF13905Thioredoxin_868-110 aa
PF13899Thioredoxin_768-125 aa
PF13848Thioredoxin_697-154 aa
PF13905Thioredoxin_8107-128 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G105040PF05296TAS2R17680.2211.3
TkA08G105040PF00085Thioredoxin501525.4e-2794.5
TkA08G105040PF20207PedC-like531320.001319.5
TkA08G105040PF13098Thioredoxin_2671529.2e-0833.1
TkA08G105040PF13905Thioredoxin_8681106.8e-0523.9
TkA08G105040PF13899Thioredoxin_7681250.001219.7
TkA08G105040PF13848Thioredoxin_6971546.7e-0833.3
TkA08G105040PF13905Thioredoxin_81071286.8e-0523.9
TkA08G105040PF13905Thioredoxin_81752326.8e-0523.9
TkA08G105040PF13848Thioredoxin_61903466.7e-0833.3
TkA08G105040PF13098Thioredoxin_22102279.2e-0833.1
TkA08G105040PF20207PedC-like2162290.001319.5
TkA08G105040PF13098Thioredoxin_22663309.2e-0833.1
TkA08G105040PF13905Thioredoxin_82973386.8e-0523.9
TkA08G105040PF00085Thioredoxin3053515.4e-2794.5
TkA08G105040PF13899Thioredoxin_73183410.001219.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94F09Arabidopsis thalianasp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-259.100%Swiss-ProtHigh
Q9XI01Arabidopsis thalianasp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-134.700%Swiss-ProtMedium
Q0JD42Oryza sativa subsp. japonicasp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-257.300%Swiss-ProtHigh
Q0E0I1Oryza sativa subsp. japonicasp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-355.900%Swiss-ProtHigh

JBrowse

View in Genome Browser