LXL04_031404 | RubberDandelionOmics

Gene overview

LXL04_031404

Reference: OH-1004 Chr: Chr07 Coordinates: 5471652-5473658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1348 bp · LXL04_031404|LXL04_031404|OH1004|cDNA

ATCCATGGTTTTGGAGCAGTTTAGCTTCCATTGTGGTGTTTCTGGGAATTCTTCAAAGATGTCATCCTCCGTCTTCTTAATACTGTCACTTTCCATCGTCTCGCTTCTAGTCCCGTCGATCTCTTCGCACGAGTTTAAGGTCAATGGGAAGGTGTTGGTGCTTGATGAATCGAACTTCGAAGCCGCAATTTCTTCCTTCGACTTCATCTTCGTTAGTTTTTATGCCCCATGGTGTGGCCACTGCAAACGTCTTAATCCAG...

CDS

Download CDS FASTA

1344 bp · LXL04_031404|LXL04_031404|OH1004|CDS

ATGGTTTTGGAGCAGTTTAGCTTCCATTGTGGTGTTTCTGGGAATTCTTCAAAGATGTCATCCTCCGTCTTCTTAATACTGTCACTTTCCATCGTCTCGCTTCTAGTCCCGTCGATCTCTTCGCACGAGTTTAAGGTCAATGGGAAGGTGTTGGTGCTTGATGAATCGAACTTCGAAGCCGCAATTTCTTCCTTCGACTTCATCTTCGTTAGTTTTTATGCCCCATGGTGTGGCCACTGCAAACGTCTTAATCCAGAGTT...

Protein

Download Protein FASTA

447 aa · LXL04_031404|LXL04_031404|OH1004|PROTEIN

MVLEQFSFHCGVSGNSSKMSSSVFLILSLSIVSLLVPSISSHEFKVNGKVLVLDESNFEAAISSFDFIFVSFYAPWCGHCKRLNPELDKAAPMLSGLKDPIVIAKIDADKYHRIAKKYDIDGFPTLKIFMHGLPTDYYGPRKADKLVRYLKKFVAPDITVLESDSGITEFVDSAGTFFPIFIGFGVDESALSKVSVKFKKNAWFSIAKDFSEKTMTLFDFDKTPALVALHPSFNEQNIFYGPFEEKFVEEFVQQSLLPLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031404`
TK1151 ID	TkA08G105040
OH-1004 ID	LXL04_031404
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031404

Location Chr07:5471652-5473658 (-)

Description Similar to PDIL5-2: Protein disulfide-isomerase 5-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35620`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release
`At1g21750`	Protein disulfide isomerase that associates with RD21A protease for trafficking from the ER through the Golgi to lytic and protein storage vacuoles of endothelial cells in developing seeds.	Arabidopsis protein disulfide isomerase-5 inhibits cysteine proteases during trafficking to vacuoles before programmed cell death of the endothelium in developing seeds.2008 · DOI: 10.1105/tpc.108.058339

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0432500`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release
`Os02g0550300`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0048316 seed development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0000327 lytic vacuole within protein storage vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

KEGG gene cross-reference

ath:AT1G21750

ath:AT1G35620

dosa:Os02g0550300

dosa:Os04g0432500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.798

Rank 1 · LXL04_031404 · OH-1004

Golgi apparatus0.126

Rank 2 · LXL04_031404 · OH-1004

Nucleus0.093

Rank 3 · LXL04_031404 · OH-1004

Cytoplasm0.091

Rank 4 · LXL04_031404 · OH-1004

Cell membrane0.045

Rank 5 · LXL04_031404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin50-152 aa

PF13098.14Thioredoxin_267-152 aa

PF13848.13Thioredoxin_6190-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031404	`PF00085.27`	Thioredoxin	50	152	5.6e-27	94.5
LXL04_031404	`PF13098.14`	Thioredoxin_2	67	152	1.1e-07	32.9
LXL04_031404	`PF13848.13`	Thioredoxin_6	190	346	4.8e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F09`	Arabidopsis thaliana	Protein disulfide-isomerase 5-2	60.145%	Swiss-Prot	strong database homology
`Q9XI01`	Arabidopsis thaliana	Protein disulfide isomerase-like 1-1	34.448%	Swiss-Prot	moderate database homology
`Q0JD42`	Oryza sativa subsp. japonica	Protein disulfide isomerase-like 5-2	56.676%	Swiss-Prot	strong database homology
`Q0E0I1`	Oryza sativa subsp. japonica	Protein disulfide isomerase-like 5-3	56.056%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card