TkA08G104780 | RubberDandelionOmics

Gene overview

TkA08G104780

Reference: TK1151 Chr: Chr08 Coordinates: 27204597-27207353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1701 bp · TkA08G104780|TK1151|cDNA

TTAAAATTCAGGTGACGAGACACTTCGCGCCTCCTTCTTCCGTATCAGATTCAGTCAGAAATCGTTATGCAGCCGCTAGAAGTGGGTACTCGCGTTCTGTGCCGATGGCGGGACGGCAAACATCATCCCGTCAAGGTCATCGAACGGCGTAGACTCCACGCCGATGGACCAAATGACTACGAGTATTACGTTCATTACACAGAGTTCAACAGGAGGCTTGATGAATGGGTTAGACTTGAACAGCTTGACCTTGACTCAGT...

CDS

Download CDS FASTA

834 bp · TkA08G104780|TK1151|CDS

ATGCAGCCGCTAGAAGTGGGTACTCGCGTTCTGTGCCGATGGCGGGACGGCAAACATCATCCCGTCAAGGTCATCGAACGGCGTAGACTCCACGCCGATGGACCAAATGACTACGAGTATTACGTTCATTACACAGAGTTCAACAGGAGGCTTGATGAATGGGTTAGACTTGAACAGCTTGACCTTGACTCAGTAGAAAATGATGTAGATGAAAAGGTGGAAGACAAGGTAACAGGTTTGAAAATGACACGTCACCAGAA...

Protein

Download Protein FASTA

277 aa · TkA08G104780|TK1151|PROTEIN

MQPLEVGTRVLCRWRDGKHHPVKVIERRRLHADGPNDYEYYVHYTEFNRRLDEWVRLEQLDLDSVENDVDEKVEDKVTGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDSLNLYFCEFCLTFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G104780`
TK1151 ID	TkA08G104780
OH-1004 ID	LXL04_031398
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.946 / OH-1004 94.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G104780

Location Chr08:27204597-27207353 (+)

Description Similar to HAM2: Histone acetyltransferase of the MYST family 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09740`	Histone acetyltransferase which may be involved in transcriptional activation.	In vitro specificities of Arabidopsis co-activator histone acetyltransferases: implications for histone hyperacetylation in gene activation.2007 · DOI: 10.1111/j.1365-313x.2007.03264.x The MYST histone acetyltransferases are essential for gametophyte development in Arabidopsis.2008 · DOI: 10.1186/1471-2229-8-121 Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2012.11.007
`At5g64610`	Histone acetyltransferase which may be involved in transcriptional activation.	In vitro specificities of Arabidopsis co-activator histone acetyltransferases: implications for histone hyperacetylation in gene activation.2007 · DOI: 10.1111/j.1365-313x.2007.03264.x The MYST histone acetyltransferases are essential for gametophyte development in Arabidopsis.2008 · DOI: 10.1186/1471-2229-8-121 Participation of chromatin-remodeling proteins in the repair of ultraviolet-B-damaged DNA.2012 · DOI: 10.1104/pp.111.191452 Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2012.11.007

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0626600`	Histone acetyltransferase which may be involved in transcriptional activation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031398 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0032480 negative regulation of type I interferon production Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:1903108 regulation of mitochondrial transcription Biological Process

KEGG gene cross-reference

ath:AT5G09740

ath:AT5G64610

dosa:Os07g0626600

hsa:84148

rno:310194

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · TkA08G104780 · TK1151

Cytoplasm0.272

Rank 2 · TkA08G104780 · TK1151

Mitochondrion0.036

Rank 3 · TkA08G104780 · TK1151

Cell membrane0.028

Rank 4 · TkA08G104780 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA08G104780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11717Tudor-knot4-62 aa

PF22732MSL3_chromo-like23-67 aa

PF13894zf-C2H2_481-88 aa

PF17772zf-MYST115-169 aa

PF13894zf-C2H2_4147-168 aa

PF01853MOZ_SAS173-264 aa

PF17772zf-MYST198-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G104780	`PF11717`	Tudor-knot	4	62	2.1e-21	76.3
TkA08G104780	`PF22732`	MSL3_chromo-like	23	67	0.014	16.1
TkA08G104780	`PF13894`	zf-C2H2_4	81	88	2.5	9.7
TkA08G104780	`PF17772`	zf-MYST	115	169	6.8e-25	87.2
TkA08G104780	`PF13894`	zf-C2H2_4	147	168	2.5	9.7
TkA08G104780	`PF01853`	MOZ_SAS	173	264	3.2e-50	171.3
TkA08G104780	`PF17772`	zf-MYST	198	217	6.8e-25	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXD7`	Arabidopsis thaliana	sp\|Q9LXD7\|MYST2_ARATH Histone acetyltransferase of the MYST family 2	90.900%	Swiss-Prot	High
`Q9FLF7`	Arabidopsis thaliana	sp\|Q9FLF7\|MYST1_ARATH Histone acetyltransferase of the MYST family 1	90.000%	Swiss-Prot	High
`Q8LI34`	Oryza sativa subsp. japonica	sp\|Q8LI34\|MYST1_ORYSJ Putative MYST-like histone acetyltransferase 1	90.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card