LXL04_031398 | RubberDandelionOmics

Gene overview

LXL04_031398

Reference: OH-1004 Chr: Chr07 Coordinates: 5399678-5401432 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_031398|LXL04_031398|OH1004|cDNA

ATGCAGCCGCTAGAAGTGGGTACTCGCGTTCTGTGCCGATGGCGGGACGGCAAACATCATCCCGTCAAGGTCATCGAACGGCGTAGACTCCACGCCGATGGACCAAATGACTACGAGTATTACGTTCATTACACAGAGTTCAACAGGAGGCTTGATGAATGGGTTAGACTTGAACAGCTTGACCTTGACTCAGTAGAaaatgatgtagatgaaaagGTGGAAGACAAGGTAACAGGTTTGAAAATGACACGTCACCAGAA...

CDS

Download CDS FASTA

834 bp · LXL04_031398|LXL04_031398|OH1004|CDS

ATGCAGCCGCTAGAAGTGGGTACTCGCGTTCTGTGCCGATGGCGGGACGGCAAACATCATCCCGTCAAGGTCATCGAACGGCGTAGACTCCACGCCGATGGACCAAATGACTACGAGTATTACGTTCATTACACAGAGTTCAACAGGAGGCTTGATGAATGGGTTAGACTTGAACAGCTTGACCTTGACTCAGTAGAAAATGATGTAGATGAAAAGGTGGAAGACAAGGTAACAGGTTTGAAAATGACACGTCACCAGAA...

Protein

Download Protein FASTA

277 aa · LXL04_031398|LXL04_031398|OH1004|PROTEIN

MQPLEVGTRVLCRWRDGKHHPVKVIERRRLHADGPNDYEYYVHYTEFNRRLDEWVRLEQLDLDSVENDVDEKVEDKVTGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDSLNLYFCEFCLTFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031398`
TK1151 ID	TkA08G104780
OH-1004 ID	LXL04_031398
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.946 / OH-1004 94.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031398

Location Chr07:5399678-5401432 (+)

Description Similar to HAM2: Histone acetyltransferase of the MYST family 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09740`	Histone acetyltransferase which may be involved in transcriptional activation.	In vitro specificities of Arabidopsis co-activator histone acetyltransferases: implications for histone hyperacetylation in gene activation.2007 · DOI: 10.1111/j.1365-313x.2007.03264.x The MYST histone acetyltransferases are essential for gametophyte development in Arabidopsis.2008 · DOI: 10.1186/1471-2229-8-121 Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2012.11.007
`At5g64610`	Histone acetyltransferase which may be involved in transcriptional activation.	In vitro specificities of Arabidopsis co-activator histone acetyltransferases: implications for histone hyperacetylation in gene activation.2007 · DOI: 10.1111/j.1365-313x.2007.03264.x The MYST histone acetyltransferases are essential for gametophyte development in Arabidopsis.2008 · DOI: 10.1186/1471-2229-8-121 Participation of chromatin-remodeling proteins in the repair of ultraviolet-B-damaged DNA.2012 · DOI: 10.1104/pp.111.191452 Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis.2013 · DOI: 10.1016/j.jplph.2012.11.007

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0626600`	Histone acetyltransferase which may be involved in transcriptional activation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031398 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0032480 negative regulation of type I interferon production Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:1903108 regulation of mitochondrial transcription Biological Process

KEGG gene cross-reference

ath:AT5G09740

ath:AT5G64610

dosa:Os07g0626600

hsa:84148

rno:310194

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.831

Rank 1 · LXL04_031398 · OH-1004

Cytoplasm0.246

Rank 2 · LXL04_031398 · OH-1004

Mitochondrion0.030

Rank 3 · LXL04_031398 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_031398 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_031398 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11717.15Tudor-knot4-62 aa

PF17772.8zf-MYST115-169 aa

PF01853.26MOZ_SAS173-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031398	`PF11717.15`	Tudor-knot	4	62	1.9e-21	76.4
LXL04_031398	`PF17772.8`	zf-MYST	115	169	6.8e-25	87.2
LXL04_031398	`PF01853.26`	MOZ_SAS	173	274	8.2e-57	192.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXD7`	Arabidopsis thaliana	Histone acetyltransferase of the MYST family 2	91.241%	Swiss-Prot	strong database homology
`Q9FLF7`	Arabidopsis thaliana	Histone acetyltransferase of the MYST family 1	90.441%	Swiss-Prot	strong database homology
`Q8LI34`	Oryza sativa subsp. japonica	Putative MYST-like histone acetyltransferase 1	91.241%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card