TkA08G096040 | RubberDandelionOmics

Gene overview

TkA08G096040

Reference: TK1151 Chr: Chr08 Coordinates: 24860164-24860571 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA08G096040|TK1151|cDNA

CTTTCTATCTCCAGGGACCAAAATGCTGTTTCGTTGGTTTGCAAGTCGTGGGACGAGATCGAGAGATGGTGCCGGAGGAGTATTTTCGTCGGGAACTGTTACGCTGTTAGTCCACAGATCATGATTCGGAGGTTTCCAGAAGTGAGATTCGTGGAGTTGAAAGGGAAGCCGCATTTTGCAGATTTCAATTTGGTACCGGATGGTTGGGGAGGGTATTTTTACCCTTGGATCTCTGAAATGTCTAGGGCTTACCCGTGGTT...

CDS

Download CDS FASTA

408 bp · TkA08G096040|TK1151|CDS

CTTTCTATCTCCAGGGACCAAAATGCTGTTTCGTTGGTTTGCAAGTCGTGGGACGAGATCGAGAGATGGTGCCGGAGGAGTATTTTCGTCGGGAACTGTTACGCTGTTAGTCCACAGATCATGATTCGGAGGTTTCCAGAAGTGAGATTCGTGGAGTTGAAAGGGAAGCCGCATTTTGCAGATTTCAATTTGGTACCGGATGGTTGGGGAGGGTATTTTTACCCTTGGATCTCTGAAATGTCTAGGGCTTACCCGTGGTT...

Protein

Download Protein FASTA

135 aa · TkA08G096040|TK1151|PROTEIN

LSISRDQNAVSLVCKSWDEIERWCRRSIFVGNCYAVSPQIMIRRFPEVRFVELKGKPHFADFNLVPDGWGGYFYPWISEMSRAYPWLEEIKLKQMVVTDEGLELISKSFRNFKVLVLSSCEFSTDGLAAIAANCR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G096040`
TK1151 ID	TkA08G096040
OH-1004 ID	LXL04_031232
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 98.519 / OH-1004 25.725 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G096040

Location Chr08:24860164-24860571 (-)

Description Similar to TIR1: Protein TRANSPORT INHIBITOR RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62980`	Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription.	Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana.1999 · DOI: 10.1101/gad.13.13.1678 Five components of the ethylene-response pathway identified in a screen for weak ethylene-insensitive mutants in Arabidopsis.2003 · DOI: 10.1073/pnas.0438070100 The Arabidopsis F-box protein TIR1 is an auxin receptor.2005 · DOI: 10.1038/nature03542 A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088 Small-molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling.2008 · DOI: 10.1073/pnas.0711146105 The TIR1 protein of Arabidopsis functions in auxin response and is related to human SKP2 and yeast grr1p.1998 · DOI: 10.1101/gad.12.2.198
`At4g03190`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	Cloning by pathway activation in yeast: identification of an Arabidopsis thaliana F-box protein that can turn on glucose repression.2002 · DOI: 10.1023/a:1014440531842
`At1g12820`	Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity).	No verified direct reference in this release
`At3g26810`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0395600`	Transport inhibitor response 1-like protein Os04g0395600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0045014 carbon catabolite repression of transcription by glucose Biological Process

GO:0048443 stamen development Biological Process

KEGG gene cross-reference

ath:AT1G12820

ath:AT3G26810

ath:AT3G62980

ath:AT4G03190

dosa:Os04g0395600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.590

Rank 1 · TkA08G096040 · TK1151

Cytoplasm0.230

Rank 2 · TkA08G096040 · TK1151

Plastid0.120

Rank 3 · TkA08G096040 · TK1151

Cell membrane0.051

Rank 4 · TkA08G096040 · TK1151

Mitochondrion0.042

Rank 5 · TkA08G096040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18511F-box_54-26 aa

PF18791Transp_inhibit46-92 aa

PF13516LRR_697-106 aa

PF13516LRR_6111-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G096040	`PF18511`	F-box_5	4	26	9.1e-08	32.2
TkA08G096040	`PF18791`	Transp_inhibit	46	92	6.1e-26	90.4
TkA08G096040	`PF13516`	LRR_6	97	106	0.0039	17.8
TkA08G096040	`PF13516`	LRR_6	111	131	0.0039	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q570C0`	Arabidopsis thaliana	sp\|Q570C0\|TIR1_ARATH Protein TRANSPORT INHIBITOR RESPONSE 1	77.900%	Swiss-Prot	High
`Q9ZR12`	Arabidopsis thaliana	sp\|Q9ZR12\|GRH1_ARATH GRR1-like protein 1	67.700%	Swiss-Prot	High
`Q9LPW7`	Arabidopsis thaliana	sp\|Q9LPW7\|AFB3_ARATH Protein AUXIN SIGNALING F-BOX 3	62.900%	Swiss-Prot	High
`Q9LW29`	Arabidopsis thaliana	sp\|Q9LW29\|AFB2_ARATH Protein AUXIN SIGNALING F-BOX 2	63.600%	Swiss-Prot	High
`Q7XVM8`	Oryza sativa subsp. japonica	sp\|Q7XVM8\|TIR1B_ORYSJ Transport inhibitor response 1-like protein Os04g0395600	60.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card