TkA08G092310 | RubberDandelionOmics

Gene overview

TkA08G092310

Reference: TK1151 Chr: Chr08 Coordinates: 23892376-23906703 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5071 bp · TkA08G092310|TK1151|cDNA

CCTATAAACCCTCGCTCAGGTCTCTCCTCAAATACACATCAAATTCACGGACAAGTTTCCCTTGTGAATTCTCTCTCTCCCCTCCCCTCACTCCTACTTTTGCTCTACTGGATTTGAATCAGCAAATACGCACACAAACAATCAACCACAGGTATTGGGGATATATACTTATACGACTTTGGCTATGTACGGGTTTGACTTATCTGAATCTAATTAGGGCACATGTGATTTAGGTTATCATGTTTCATAGTTAATTGGAG...

CDS

Download CDS FASTA

1164 bp · TkA08G092310|TK1151|CDS

ATGAGTAGTAGTAGTACTAGTCTGTATCAGGATACATCAGTGGAACGTCTTCTTCGTGAGGTGACTAATGACAAGTTCTGGCAGCATCCAGAGGAGGCAGAACTCGAGCGCGTTCCTGGAACCTTTGAATCCGTAGAAGAATATATTAAAGTGTTCGAGCCTTTGCTTTTTGAGGAATGCCGAGCACAACTCTACAGCACCTGGGAAGAATCCACCGAAATGTCTACATCCGCCAAAGAGCATCCAATGGTCCGTATCAA...

Protein

Download Protein FASTA

387 aa · TkA08G092310|TK1151|PROTEIN

MSSSSTSLYQDTSVERLLREVTNDKFWQHPEEAELERVPGTFESVEEYIKVFEPLLFEECRAQLYSTWEESTEMSTSAKEHPMVRIKTVERRERGWYDVILVPSNECRWNFKEGDVAVLSTPRPGTVISKRASVGEDPEVTGRVAGTVRRHIPIDTRDPMGAILHFYVGDSYDSKGDNDDHILNKLHPKGVWFLTFLGSLATTQREYIALHAFRRLNSKMQTAILQPSPEMFPKYEEQAPAMPDCFTPNFVDYLHRTFNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G092310`
TK1151 ID	TkA08G092310
OH-1004 ID	LXL04_031182
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 97.674 / OH-1004 14.527 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G092310`
Location	Chr08:23892376-23906703 (+)
Description	Similar to SPBC29A10.10c: Uncharacterized ATP-dependent helicase C29A10.10c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031182` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006283 transcription-coupled nucleotide-excision repair Biological Process GO:0006353 DNA-templated transcription termination Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006364 rRNA processing Biological Process GO:0006369 termination of RNA polymerase II transcription Biological Process GO:0006386 termination of RNA polymerase III transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0006399 tRNA metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0008033 tRNA processing Biological Process GO:0016180 snRNA processing Biological Process GO:0031123 RNA 3'-end processing Biological Process
KEGG gene cross-reference	sce:YLR430W spo:2540523 spo:2541556 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.425

Rank 1 · TkA08G092310 · TK1151

Nucleus0.385

Rank 2 · TkA08G092310 · TK1151

Mitochondrion0.210

Rank 3 · TkA08G092310 · TK1151

Peroxisome0.070

Rank 4 · TkA08G092310 · TK1151

Cell membrane0.059

Rank 5 · TkA08G092310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20073DUF646911-127 aa

PF13086AAA_11258-319 aa

PF13191AAA_16284-329 aa

PF01637ATPase_2285-339 aa

PF13245AAA_19289-330 aa

PF13604AAA_30290-329 aa

PF00004AAA292-352 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G092310	`PF20073`	DUF6469	11	127	5.7e-07	29.9
TkA08G092310	`PF13086`	AAA_11	258	319	4.2e-08	34.0
TkA08G092310	`PF13191`	AAA_16	284	329	0.021	16.1
TkA08G092310	`PF01637`	ATPase_2	285	339	0.2	12.2
TkA08G092310	`PF13245`	AAA_19	289	330	0.017	16.0
TkA08G092310	`PF13604`	AAA_30	290	329	0.11	12.9
TkA08G092310	`PF00004`	AAA	292	352	0.16	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card