TkA08G092160 | RubberDandelionOmics

Gene overview

TkA08G092160

Reference: TK1151 Chr: Chr08 Coordinates: 23823960-23824457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA08G092160|TK1151|cDNA

ATGGTTCCACAATTGGAGAAGCTTCACATTACTGACACATCTTCTGCTAATAAGTTATATGAAGTTACTGTACCGAATTGCCCCCAGAAGATCAAGTCCTTCAAGTTGGACAAAGTGTGCATACATATAGGCATCACAAGTGACATTGATGCCCTTGCCATTGCAAACATCATGCCAGAGTTGCGCCATTTGCAGTTGTATGGCAATGCCATGTCAGACATTGGACTCAAAGCCATTCTTGATGGATGCCCTCACCTCGA...

CDS

Download CDS FASTA

450 bp · TkA08G092160|TK1151|CDS

ATGGTTCCACAATTGGAGAAGCTTCACATTACTGACACATCTTCTGCTAATAAGTTATATGAAGTTACTGTACCGAATTGCCCCCAGAAGATCAAGTCCTTCAAGTTGGACAAAGTGTGCATACATATAGGCATCACAAGTGACATTGATGCCCTTGCCATTGCAAACATCATGCCAGAGTTGCGCCATTTGCAGTTGTATGGCAATGCCATGTCAGACATTGGACTCAAAGCCATTCTTGATGGATGCCCTCACCTCGA...

Protein

Download Protein FASTA

149 aa · TkA08G092160|TK1151|PROTEIN

MVPQLEKLHITDTSSANKLYEVTVPNCPQKIKSFKLDKVCIHIGITSDIDALAIANIMPELRHLQLYGNAMSDIGLKAILDGCPHLESLDIRTCYNVDIHGNELKLCMERIKNFKGPEDSIENCGFHPRVLEYDEDYYFDEYDNPTHDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G092160`
TK1151 ID	TkA08G092160
OH-1004 ID	LXL04_031178
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.604 / OH-1004 78.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G092160

Location Chr08:23823960-23824457 (-)

Description Similar to FBL23: Putative F-box/LRR-repeat protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05490`	Putative F-box/LRR-repeat protein 22.	No verified direct reference in this release
`At4g05500`	Putative F-box/LRR-repeat protein 23.	No verified direct reference in this release
`At4g05460`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05475`	Putative F-box protein At4g05475.	No verified direct reference in this release
`At4g05470`	Putative F-box/LRR-repeat protein 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031178 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT4G05460

ath:AT4G05475

ath:AT4G05490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · TkA08G092160 · TK1151

Nucleus0.505

Rank 2 · TkA08G092160 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA08G092160 · TK1151

Cell membrane0.051

Rank 4 · TkA08G092160 · TK1151

Extracellular0.030

Rank 5 · TkA08G092160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_43-12 aa

PF13855LRR_83-13 aa

PF13516LRR_65-12 aa

PF00560LRR_15-14 aa

PF24758LRR_At5g5637028-105 aa

PF23286LRR_1341-98 aa

PF12799LRR_444-74 aa

PF13855LRR_848-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G092160	`PF12799`	LRR_4	3	12	2.4e-07	31.5
TkA08G092160	`PF13855`	LRR_8	3	13	0.0058	17.1
TkA08G092160	`PF13516`	LRR_6	5	12	0.00063	20.3
TkA08G092160	`PF00560`	LRR_1	5	14	0.4	11.7
TkA08G092160	`PF24758`	LRR_At5g56370	28	105	8.8e-08	32.8
TkA08G092160	`PF23286`	LRR_13	41	98	0.012	16.0
TkA08G092160	`PF12799`	LRR_4	44	74	2.4e-07	31.5
TkA08G092160	`PF13855`	LRR_8	48	92	0.0058	17.1
TkA08G092160	`PF12799`	LRR_4	59	94	2.4e-07	31.5
TkA08G092160	`PF25372`	LRR_FBXL15	59	102	0.038	13.1
TkA08G092160	`PF13516`	LRR_6	61	79	0.00063	20.3
TkA08G092160	`PF00560`	LRR_1	61	76	0.4	11.7
TkA08G092160	`PF13516`	LRR_6	83	92	0.00063	20.3
TkA08G092160	`PF00560`	LRR_1	85	101	0.4	11.7
TkA08G092160	`PF00560`	LRR_1	121	126	0.4	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0U6`	Arabidopsis thaliana	sp\|Q9M0U6\|FBL22_ARATH Putative F-box/LRR-repeat protein 22	43.200%	Swiss-Prot	Medium
`Q9S9V9`	Arabidopsis thaliana	sp\|Q9S9V9\|FBL23_ARATH Putative F-box/LRR-repeat protein 23	44.600%	Swiss-Prot	Medium
`Q9M0U9`	Arabidopsis thaliana	sp\|Q9M0U9\|SKI19_ARATH F-box protein SKIP19	47.000%	Swiss-Prot	Medium
`Q9M0U7`	Arabidopsis thaliana	sp\|Q9M0U7\|FB221_ARATH Putative F-box protein At4g05475	48.100%	Swiss-Prot	Medium
`Q9M0U8`	Arabidopsis thaliana	sp\|Q9M0U8\|FBL21_ARATH Putative F-box/LRR-repeat protein 21	41.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card