LXL04_031178 | RubberDandelionOmics

Gene overview

LXL04_031178

Reference: OH-1004 Chr: Chr07 Coordinates: 1887233-1887751 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_031178|LXL04_031178|OH1004|cDNA

ATGAACAGCTCAACTAAACTCATCAGTCTTTTCCTTAAGGACTGCTACCATGTCACGAGCGAAAGGCTGAATCATGCACTCAAAATGGTTCCACAATTGGAGAAGCTTCACATTACTGACACATCTTCTGCTAATAAGTTATATGAAGTTACTGTACCGAATTGCCCCCAGAAGATCAAGTCCTTCAAGTTGGACAAAGTGTGCATACATATAGGCATCACAAGTGACATTGATGCCCTTGCCATTGCAAACATCATGCC...

CDS

Download CDS FASTA

519 bp · LXL04_031178|LXL04_031178|OH1004|CDS

ATGAACAGCTCAACTAAACTCATCAGTCTTTTCCTTAAGGACTGCTACCATGTCACGAGCGAAAGGCTGAATCATGCACTCAAAATGGTTCCACAATTGGAGAAGCTTCACATTACTGACACATCTTCTGCTAATAAGTTATATGAAGTTACTGTACCGAATTGCCCCCAGAAGATCAAGTCCTTCAAGTTGGACAAAGTGTGCATACATATAGGCATCACAAGTGACATTGATGCCCTTGCCATTGCAAACATCATGCC...

Protein

Download Protein FASTA

172 aa · LXL04_031178|LXL04_031178|OH1004|PROTEIN

MNSSTKLISLFLKDCYHVTSERLNHALKMVPQLEKLHITDTSSANKLYEVTVPNCPQKIKSFKLDKVCIHIGITSDIDALAIANIMPELRHLQLYGNAMSDIGLKAILDGCPHLESLDIRTCYNVDIHGNELKLCMERIKNFKGPEDSIENCGFHPRVLEYDEPTKSCGFRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031178`
TK1151 ID	TkA08G092160
OH-1004 ID	LXL04_031178
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.604 / OH-1004 78.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031178

Location Chr07:1887233-1887751 (-)

Description Similar to FBL23: Putative F-box/LRR-repeat protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05500`	Putative F-box/LRR-repeat protein 23.	No verified direct reference in this release
`At4g05460`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05490`	Putative F-box/LRR-repeat protein 22.	No verified direct reference in this release
`At4g05475`	Putative F-box protein At4g05475.	No verified direct reference in this release
`At4g05470`	Putative F-box/LRR-repeat protein 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031178 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT4G05460

ath:AT4G05475

ath:AT4G05490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · LXL04_031178 · OH-1004

Nucleus0.488

Rank 2 · LXL04_031178 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_031178 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_031178 · OH-1004

Mitochondrion0.026

Rank 5 · LXL04_031178 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24758.2LRR_At5g5637069-133 aa

PF12799.14LRR_487-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031178	`PF24758.2`	LRR_At5g56370	69	133	4.9e-09	36.9
LXL04_031178	`PF12799.14`	LRR_4	87	122	3.9e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9V9`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 23	41.781%	Swiss-Prot	moderate database homology
`Q9M0U9`	Arabidopsis thaliana	F-box protein SKIP19	43.243%	Swiss-Prot	moderate database homology
`Q9M0U6`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 22	49.000%	Swiss-Prot	moderate database homology
`Q9M0U7`	Arabidopsis thaliana	Putative F-box protein At4g05475	41.259%	Swiss-Prot	moderate database homology
`Q9M0U8`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 21	39.130%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card