TkA08G080070 | RubberDandelionOmics

Gene overview

TkA08G080070

Reference: TK1151 Chr: Chr08 Coordinates: 20547976-20552412 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · TkA08G080070|TK1151|cDNA

ATTATACACAATTTTTAGACATAAATTGTTAGTATACATTAAAATTGTTGTGTATGAATTGATTATCACTTATTATTTAGGTTGTTTGCTTTACAAAATTATACAATTCACATATTTTGCATCATTCTTAAACATATTCGTATCTATTATTTGGGAAGTTTCCACTTTGCACTTGAAAAATAAAAACTACAGAAAAAACACAAAACTGCAAGAACAGGTGAATTTAATTGCTTTCCCAAGTCCTCCTTGTAGGTCAGTTC...

CDS

Download CDS FASTA

597 bp · TkA08G080070|TK1151|CDS

ATGGTGAGAGGATTATTAAACAAACTCGCAACTAAATCGATCACTGTTGCCGGAAAATGGCAACAGCAGCAGCTCCGTCGCCTCAACATCCACGAGTATCAGGGAGCTGAATTGATGGGCAAATTCGGTATTAATGTTCCAAAAGGTGTTGCTGTTTCTTCTGTTGAAGAAGTTAGAAAGGCCATACAAACAACATTTCCCAATGAAAAGGAGTTGGTGGTTAAGAGCCAAATTCTAGCTGGTGGACGTGGTCTAGGAAA...

Protein

Download Protein FASTA

198 aa · TkA08G080070|TK1151|PROTEIN

MVRGLLNKLATKSITVAGKWQQQQLRRLNIHEYQGAELMGKFGINVPKGVAVSSVEEVRKAIQTTFPNEKELVVKSQILAGGRGLGKFTSGLQGGVHIVKIEQVEEIAGKMLGQTLVTKQTGPQGKVVSKVYLCEKVSLVNEMYFAITLDRTTAGPLIIACREGGTSIEDLAEKFPDMIIKVPIDVSKELQMKMLLKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080070`
TK1151 ID	TkA08G080070
OH-1004 ID	LXL04_036848
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 94.949 / OH-1004 25.371 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G080070

Location Chr08:20547976-20552412 (+)

Description Similar to At2g20420: Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20420`	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0621700`	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036848 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006104 succinyl-CoA metabolic process Biological Process

GO:0006105 succinate metabolic process Biological Process

GO:0015786 UDP-glucose transmembrane transport Biological Process

GO:0048527 lateral root development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0072334 UDP-galactose transmembrane transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G20420

ath:AT4G31600

ddi:DDB_G0271842

dosa:Os02g0621700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.920

Rank 1 · TkA08G080070 · TK1151

Cytoplasm0.074

Rank 2 · TkA08G080070 · TK1151

Nucleus0.039

Rank 3 · TkA08G080070 · TK1151

Plastid0.024

Rank 4 · TkA08G080070 · TK1151

Extracellular0.018

Rank 5 · TkA08G080070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27128Rv1109c_N3-26 aa

PF29032MRL1_C11-46 aa

PF08442ATP-grasp_229-194 aa

PF24948Citrate_synth_N32-195 aa

PF01071GARS_A37-85 aa

PF27128Rv1109c_N42-61 aa

PF27128Rv1109c_N95-112 aa

PF27128Rv1109c_N172-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080070	`PF27128`	Rv1109c_N	3	26	0.06	13.7
TkA08G080070	`PF29032`	MRL1_C	11	46	0.084	13.5
TkA08G080070	`PF08442`	ATP-grasp_2	29	194	1.6e-48	165.7
TkA08G080070	`PF24948`	Citrate_synth_N	32	195	0.00017	21.8
TkA08G080070	`PF01071`	GARS_A	37	85	0.068	13.7
TkA08G080070	`PF27128`	Rv1109c_N	42	61	0.06	13.7
TkA08G080070	`PF27128`	Rv1109c_N	95	112	0.06	13.7
TkA08G080070	`PF27128`	Rv1109c_N	172	194	0.06	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82662`	Arabidopsis thaliana	sp\|O82662\|SUCB_ARATH Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial	82.200%	Swiss-Prot	High
`Q6K9N6`	Oryza sativa subsp. japonica	sp\|Q6K9N6\|SUCB_ORYSJ Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial	79.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card