RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G045100
Reference: TK1151 Chr: Chr08 Coordinates: 11488558-11491228 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1945 bp · TkA08G045100|TK1151|cDNA

CTGCAACATGTGGAGAGTATGAGTTGGAGAGAGGAATCTCTGGATTACAGAGATATCACTCTTGTTTTTATCCCATCATCACTCATTTCTCCTCAACACCTCTCTCATTAATCATTCATTTTTATGAAAATGACAAAAACCCTTTTCATTCTGCTAACACTTTATACTTTCGGAGAAAGAAACCTTTTCATGAGTTCTTATCAAAGGGAGAGAAAGAGGTAAAAACACAACATTGAACAATCTCCCTTCGTTACTCAAAA...

CDS

Download CDS FASTA

1497 bp · TkA08G045100|TK1151|CDS

ATGGGAGCTTGTTGTTCTTGTTTTTCGTTCTCGTTGTGTCGATGTTGTTGTTTCAAATCCAAGCACCCTCGTTCCTCCGATCTAGAGAACCGCGGTGGTGACGATGACAAGCTAAAGTGGCCGTGTTTTCGGGAGTACAAACTAGACGAGCTTAAAACTGCAACCGGTGGGTTTTCCATCGAGAATGTGGTGTCGGAGCACGGCGAGAAGGCCCCCAACGTCGTCTACAAAGGAAAACTCCCGGACAGCGACTCTCTCAT...

Protein

Download Protein FASTA

498 aa · TkA08G045100|TK1151|PROTEIN

MGACCSCFSFSLCRCCCFKSKHPRSSDLENRGGDDDKLKWPCFREYKLDELKTATGGFSIENVVSEHGEKAPNVVYKGKLPDSDSLIAVKRFNKSAWPDTRQFLDEAKAVGQLRSHRLANLLGCCYEGDERLLIAEFMPNETLSKHLFHWENQPLKWSMRLRVALYLAQALEYCSIKGRSLYHDLNAYRVLFDQDCNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYMKTGRINAESVIYSFGTILLDLLSGKHIPPSHAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G045100
TK1151 IDTkA08G045100
OH-1004 IDLXL04_017860
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.000
Protein coverage (%)TK1151 99.598 / OH-1004 97.093
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G045100
LocationChr08:11488558-11491228 (-)
DescriptionSimilar to BSK5: Serine/threonine-protein kinase BSK5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g59010 Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.
A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118
At3g54030 Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1. No verified direct reference in this release
At1g63500 Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1. No verified direct reference in this release
At5g41260 Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.
BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
A kinase-phosphatase signaling module with BSK8 and BSL2 involved in regulation of sucrose-phosphate synthase.2014 · DOI: 10.1021/pr5003164

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0684200 Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of BRI1.
OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017860 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009409 response to cold Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT1G63500
ath:AT3G54030
ath:AT5G41260
ath:AT5G59010
dosa:Os04g0684200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627
Rank 1 · TkA08G045100 · TK1151
Cytoplasm0.236
Rank 2 · TkA08G045100 · TK1151
Nucleus0.213
Rank 3 · TkA08G045100 · TK1151
Endoplasmic reticulum0.051
Rank 4 · TkA08G045100 · TK1151
Golgi apparatus0.035
Rank 5 · TkA08G045100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr74-312 aa
PF00069Pkinase74-311 aa
PF07719TPR_2120-127 aa
PF00515TPR_1168-174 aa
PF01921tRNA-synt_1f326-384 aa
PF25575TPR_BSK1_C352-469 aa
PF07719TPR_2399-418 aa
PF29407CFAP70_TPR_C399-473 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G045100PF07714PK_Tyr_Ser-Thr743122.8e-2589.8
TkA08G045100PF00069Pkinase743111.8e-2177.5
TkA08G045100PF07719TPR_21201270.03515.0
TkA08G045100PF00515TPR_11681740.2212.1
TkA08G045100PF01921tRNA-synt_1f3263840.2411.0
TkA08G045100PF25575TPR_BSK1_C3524696.1e-61204.2
TkA08G045100PF07719TPR_23994180.03515.0
TkA08G045100PF29407CFAP70_TPR_C3994730.0513.8
TkA08G045100PF13174TPR_63994220.2213.0
TkA08G045100PF00515TPR_13994170.2212.1
TkA08G045100PF03041Baculo_LEF-24054490.02914.9
TkA08G045100PF07719TPR_24304590.03515.0
TkA08G045100PF00515TPR_14304500.2212.1
TkA08G045100PF13174TPR_64384480.2213.0
TkA08G045100PF07719TPR_24644830.03515.0
TkA08G045100PF13174TPR_64644860.2213.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FIL1Arabidopsis thalianasp|Q9FIL1|BSK5_ARATH Serine/threonine-protein kinase BSK572.900%Swiss-ProtHigh
Q9M324Arabidopsis thalianasp|Q9M324|BSK6_ARATH Serine/threonine-protein kinase BSK670.100%Swiss-ProtHigh
F4I3M3Arabidopsis thalianasp|F4I3M3|BSK7_ARATH Serine/threonine-protein kinase BSK768.600%Swiss-ProtHigh
Q9FHD7Arabidopsis thalianasp|Q9FHD7|BSK8_ARATH Serine/threonine-protein kinase BSK869.200%Swiss-ProtHigh
B9FDE0Oryza sativa subsp. japonicasp|B9FDE0|BSK3_ORYSJ Probable serine/threonine-protein kinase BSK371.900%Swiss-ProtHigh

JBrowse

View in Genome Browser