TkA07G440660 | RubberDandelionOmics

Gene overview

TkA07G440660

Reference: TK1151 Chr: Chr07 Coordinates: 111632452-111635463 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2333 bp · TkA07G440660|TK1151|cDNA

AACCAACCTACAATTGTAATTTATTTAATAAAAAGGTTGCCTGAGATCAATTGGTAATCGATATAAAATGTTGAATTTAATTAGGGTGTGCAGTAATTCATGAAGCTCCAGAATTCCAAGGAGACGAAACTCTGCGCTCATTTTTAGTGTCGCTCAAACTGTGCACACCAACTGTTTGTTGGAATGCTACCATGGTTTTTTAGGTTACAAACGTTTTCTACTTGTTAACATCAATTCCTCCTCTCACCTGCAAATGCTGA...

CDS

Download CDS FASTA

1071 bp · TkA07G440660|TK1151|CDS

ATGCTGAAGCTTTTTTCACGGCGGCCACACGACCTCCACAGCCACAAGCGGCCACCAATCCTCTTTATATTCCGTAATCTAACAAAATCCCATCTTGAAGACGACGACCCACATTTTTCCCCAATCGTCAAAACTGTAAAACACAAAAATCAGAAGAAGAAGAATCCCAAAGAAGATGAATCGAACAACAAACCTCACAACAAGTTCCCTATAGAATCCAATTTACCCTTTGATTTCAGGTACTCGTACTCTGAGACCAA...

Protein

Download Protein FASTA

356 aa · TkA07G440660|TK1151|PROTEIN

MLKLFSRRPHDLHSHKRPPILFIFRNLTKSHLEDDDPHFSPIVKTVKHKNQKKKNPKEDESNNKPHNKFPIESNLPFDFRYSYSETNPSVEPIGYRETPKFSPFGPGRLDRKWTGTVAPLQQAVDMAKVEEQKNAILGNPLSEEEVSELVERYRHNDCARQINLGKGGVTHNTIDDIHNHWKKAEAVRIKCLGVPTLDMDNVCFHLEDKTGGKIIYRKINILLIYRGRNYDPINRPVIPLMLWKPYPPIYPKLIKNVADG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G440660`
TK1151 ID	TkA07G440660
OH-1004 ID	LXL04_030941
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.438 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G440660

Location Chr07:111632452-111635463 (-)

Description Similar to At5g54890: CRS2-associated factor 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54890`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release
`At4g31010`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0188000`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release
`Os08g0174900`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release
`Os01g0323300`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0033617 mitochondrial respiratory chain complex IV assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G31010

ath:AT5G54890

dosa:Os08g0174900

dosa:Os08g0188000

zma:542682

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.844

Rank 1 · TkA07G440660 · TK1151

Mitochondrion0.135

Rank 2 · TkA07G440660 · TK1151

Nucleus0.071

Rank 3 · TkA07G440660 · TK1151

Cytoplasm0.057

Rank 4 · TkA07G440660 · TK1151

Peroxisome0.016

Rank 5 · TkA07G440660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01985CRS1_YhbY141-226 aa

PF01985CRS1_YhbY261-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G440660	`PF01985`	CRS1_YhbY	141	226	7.5e-33	113.4
TkA07G440660	`PF01985`	CRS1_YhbY	261	343	7.5e-33	113.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFU1`	Arabidopsis thaliana	sp\|Q9FFU1\|CAF2M_ARATH CRS2-associated factor 2, mitochondrial	74.000%	Swiss-Prot	High
`Q8VYD9`	Arabidopsis thaliana	sp\|Q8VYD9\|CAF1M_ARATH CRS2-associated factor 1, mitochondrial	46.900%	Swiss-Prot	Medium
`Q0J7J7`	Oryza sativa subsp. japonica	sp\|Q0J7J7\|CAF2M_ORYSJ CRS2-associated factor 2, mitochondrial	72.600%	Swiss-Prot	High
`Q6Z4U2`	Oryza sativa subsp. japonica	sp\|Q6Z4U2\|CAF1M_ORYSJ CRS2-associated factor 1, mitochondrial	53.400%	Swiss-Prot	High
`Q657G7`	Oryza sativa subsp. japonica	sp\|Q657G7\|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic	43.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card