LXL04_030941 | RubberDandelionOmics

Gene overview

LXL04_030941

Reference: OH-1004 Chr: Chr06 Coordinates: 125490559-125492496 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · LXL04_030941|LXL04_030941|OH1004|cDNA

ATGTTGAATTTAATTAGGGTGTGCAGTTACAAACGTTTTCTACTTGTTAACATCAATTCCTCCTCTCACCTGCAAATGCTGAAGCTTTTTTCACGGCGGCCACACGACCTCCACAGCCACAAGCGGCCACCAATCCTCTTTATATTCCGTAATCTAACAAAATCCCATCTTGAAGACGACGACCCACCTTTTTCCCCAATCGTCAAAACTGTAAAACAcaaaaatcagaagaagaagaatccCAAAGAAGATGAATCGAA...

CDS

Download CDS FASTA

1146 bp · LXL04_030941|LXL04_030941|OH1004|CDS

ATGTTGAATTTAATTAGGGTGTGCAGTTACAAACGTTTTCTACTTGTTAACATCAATTCCTCCTCTCACCTGCAAATGCTGAAGCTTTTTTCACGGCGGCCACACGACCTCCACAGCCACAAGCGGCCACCAATCCTCTTTATATTCCGTAATCTAACAAAATCCCATCTTGAAGACGACGACCCACCTTTTTCCCCAATCGTCAAAACTGTAAAACACAAAAATCAGAAGAAGAAGAATCCCAAAGAAGATGAATCGAA...

Protein

Download Protein FASTA

381 aa · LXL04_030941|LXL04_030941|OH1004|PROTEIN

MLNLIRVCSYKRFLLVNINSSSHLQMLKLFSRRPHDLHSHKRPPILFIFRNLTKSHLEDDDPPFSPIVKTVKHKNQKKKNPKEDESNNKPHNKFPIESNLPFDFRYSYSETNPSVEPIGYRETPKFSPFGPGRLDRKWTGTVAPLQQAVDMAKVEEQKNAILGNPLSEEEVSELVERYRHNDCARQINLGKGGVTHNTIDDIHNHWKKAEAVRIKCLGVPTLDMDNVCFHLEDKTGGKIIYRKINILLIYRGRNYDPINR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030941`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030941

Location Chr06:125490559-125492496 (-)

Description Similar to At5g54890: CRS2-associated factor 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54890`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release
`At4g31010`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0188000`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release
`Os08g0174900`	May be involved in the splicing of group IIB introns in mitochondria.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0033617 mitochondrial respiratory chain complex IV assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G31010

ath:AT5G54890

dosa:Os08g0174900

dosa:Os08g0188000

zma:542682

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.811

Rank 1 · LXL04_030941 · OH-1004

Mitochondrion0.158

Rank 2 · LXL04_030941 · OH-1004

Nucleus0.070

Rank 3 · LXL04_030941 · OH-1004

Cytoplasm0.040

Rank 4 · LXL04_030941 · OH-1004

Peroxisome0.012

Rank 5 · LXL04_030941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01985.27CRS1_YhbY166-251 aa

PF01985.27CRS1_YhbY286-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030941	`PF01985.27`	CRS1_YhbY	166	251	9.4e-33	113.1
LXL04_030941	`PF01985.27`	CRS1_YhbY	286	368	9.4e-33	113.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFU1`	Arabidopsis thaliana	CRS2-associated factor 2, mitochondrial	66.571%	Swiss-Prot	strong database homology
`Q8VYD9`	Arabidopsis thaliana	CRS2-associated factor 1, mitochondrial	52.613%	Swiss-Prot	strong database homology
`Q0J7J7`	Oryza sativa subsp. japonica	CRS2-associated factor 2, mitochondrial	72.632%	Swiss-Prot	strong database homology
`Q6Z4U2`	Oryza sativa subsp. japonica	CRS2-associated factor 1, mitochondrial	52.560%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card