TkA07G436910 | RubberDandelionOmics

Gene overview

TkA07G436910

Reference: TK1151 Chr: Chr07 Coordinates: 110590237-110595247 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA07G436910|TK1151|cDNA

CTTATTATATCCATCAAAATATCTGGCGGGAAATTGGCGTTCACTCTCTCTGTGTGTCCAAAATCTGAAAACCCTAGAAAAATCAGAAAATCACTCAAGTAAAATCAAATGGATCCAATACCGATGGAAGTATGTTTCCACGGAAGCGAAGACGATAGAGAGAATGTTGAGGAAACCACTAGTCATCTTAGAGATCGTTTCCGCCTGTCCACCATCTCCATTGCAGAGTCCGAAGCCAAACAAGATAACATGGGGATTTC...

CDS

Download CDS FASTA

504 bp · TkA07G436910|TK1151|CDS

ATGGAAGTATGTTTCCACGGAAGCGAAGACGATAGAGAGAATGTTGAGGAAACCACTAGTCATCTTAGAGATCGTTTCCGCCTGTCCACCATCTCCATTGCAGAGTCCGAAGCCAAACAAGATAACATGGGGATTTCACAATCTGTCATCGTTTGCATCTCCGATTTAGCGTTCAAGTATGCAGAACAGTTAGCAGAGGATCTCGAGATGTTTGCACATCACGCTGGTCGAAAGTCGGTGAATATGAAGGACGTTATCAT...

Protein

Download Protein FASTA

167 aa · TkA07G436910|TK1151|PROTEIN

MEVCFHGSEDDRENVEETTSHLRDRFRLSTISIAESEAKQDNMGISQSVIVCISDLAFKYAEQLAEDLEMFAHHAGRKSVNMKDVIISGTSMKTKLLNPSINLHFYGTPHSDDSFFLISAHRNKHLTDLLRTFSDTLKSKEPQSEKKRKKSSNKEGKSLPVVLDVDP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G436910`
TK1151 ID	TkA07G436910
OH-1004 ID	LXL04_030844
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 97.093 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G436910

Location Chr07:110590237-110595247 (+)

Description Similar to MHF1: Protein MHF1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50930`	Involved in the promotion of spontaneous somatic homologous recombination (HR) events, which is opposite to the function of FANCM in ordered HR.	MHF1 plays Fanconi anaemia complementation group M protein (FANCM)-dependent and FANCM-independent roles in DNA repair and homologous recombination in plants.2014 · DOI: 10.1111/tpj.12507 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.2014 · DOI: 10.1093/nar/gku614

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0006281 DNA repair Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0031297 replication fork processing Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0051301 cell division Biological Process

GO:0000776 kinetochore Cellular Component

KEGG gene cross-reference

ath:AT5G50930

bta:613732

hsa:100526739

hsa:378708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.908

Rank 1 · TkA07G436910 · TK1151

Cytoplasm0.192

Rank 2 · TkA07G436910 · TK1151

Mitochondrion0.026

Rank 3 · TkA07G436910 · TK1151

Cell membrane0.020

Rank 4 · TkA07G436910 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA07G436910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17527ALC12-50 aa

PF15630CENP-S22-87 aa

PF00125Histone38-85 aa

PF15511CENP-T_C40-87 aa

PF00808CBFD_NFYB_HMF41-86 aa

PF07524Bromo_TP45-87 aa

PF02291TFIID-31kDa46-88 aa

PF17527ALC104-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G436910	`PF17527`	ALC	12	50	0.025	15.2
TkA07G436910	`PF15630`	CENP-S	22	87	4e-15	56.7
TkA07G436910	`PF00125`	Histone	38	85	0.15	13.2
TkA07G436910	`PF15511`	CENP-T_C	40	87	3.8e-09	37.3
TkA07G436910	`PF00808`	CBFD_NFYB_HMF	41	86	0.025	15.5
TkA07G436910	`PF07524`	Bromo_TP	45	87	0.0002	22.0
TkA07G436910	`PF02291`	TFIID-31kDa	46	88	0.00018	22.3
TkA07G436910	`PF17527`	ALC	104	155	0.025	15.2
TkA07G436910	`PF00125`	Histone	142	161	0.15	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI55`	Arabidopsis thaliana	sp\|Q9FI55\|CENPS_ARATH Protein MHF1 homolog	64.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card