LXL04_030844 | RubberDandelionOmics

Gene overview

LXL04_030844

Reference: OH-1004 Chr: Chr06 Coordinates: 124058473-124059430 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_030844|LXL04_030844|OH1004|cDNA

ATGGATCCAATACCGATGGAAGTATGTTTCCACGGAAGCGAAGACGATAGAGAGAATGTTGAGGAAACCACTAGTCATCTTAGAGATCGTTTCCGCCTGTCCACCATCTCCATTGCAGAGTCCGAAGCCAAACAAGATAACATGGGGATTTCACAATCTGTCATCGTTTGCATCTCCGATTTAGCGTTCAAGTATGCAGAACAGTTAGCAGAGGATCTCGAGATGTTTGCACATCACGCTGGTCGAAAGTCGGTGAATAT...

CDS

Download CDS FASTA

519 bp · LXL04_030844|LXL04_030844|OH1004|CDS

ATGGATCCAATACCGATGGAAGTATGTTTCCACGGAAGCGAAGACGATAGAGAGAATGTTGAGGAAACCACTAGTCATCTTAGAGATCGTTTCCGCCTGTCCACCATCTCCATTGCAGAGTCCGAAGCCAAACAAGATAACATGGGGATTTCACAATCTGTCATCGTTTGCATCTCCGATTTAGCGTTCAAGTATGCAGAACAGTTAGCAGAGGATCTCGAGATGTTTGCACATCACGCTGGTCGAAAGTCGGTGAATAT...

Protein

Download Protein FASTA

172 aa · LXL04_030844|LXL04_030844|OH1004|PROTEIN

MDPIPMEVCFHGSEDDRENVEETTSHLRDRFRLSTISIAESEAKQDNMGISQSVIVCISDLAFKYAEQLAEDLEMFAHHAGRKSVNMKDVIISGTSMKTKHLNPSINLHFYGTPHSDDSFFLISAHRNKHLTDLLRTFSDTLKSKEPQSEKKRKKSSNKEGKSLPVVLDVDP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030844`
TK1151 ID	TkA07G436910
OH-1004 ID	LXL04_030844
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 97.093 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030844

Location Chr06:124058473-124059430 (+)

Description Similar to MHF1: Protein MHF1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50930`	Involved in the promotion of spontaneous somatic homologous recombination (HR) events, which is opposite to the function of FANCM in ordered HR.	MHF1 plays Fanconi anaemia complementation group M protein (FANCM)-dependent and FANCM-independent roles in DNA repair and homologous recombination in plants.2014 · DOI: 10.1111/tpj.12507 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.2014 · DOI: 10.1093/nar/gku614

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0006281 DNA repair Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0031297 replication fork processing Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0051301 cell division Biological Process

GO:0000776 kinetochore Cellular Component

KEGG gene cross-reference

ath:AT5G50930

bta:613732

hsa:100526739

hsa:378708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.915

Rank 1 · LXL04_030844 · OH-1004

Cytoplasm0.193

Rank 2 · LXL04_030844 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_030844 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_030844 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_030844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15630.13CENP-S27-92 aa

PF15511.13CENP-T_C45-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030844	`PF15630.13`	CENP-S	27	92	4.3e-15	56.6
LXL04_030844	`PF15511.13`	CENP-T_C	45	92	3.9e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI55`	Arabidopsis thaliana	Protein MHF1 homolog	49.254%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card