RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G428360
Reference: TK1151 Chr: Chr07 Coordinates: 108336920-108339260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2093 bp · TkA07G428360|TK1151|cDNA

AAATAATCCCATAGATATTGCTTGAATTTTTTTAGTAATAACTAATGTAATTATTAAATTAAATAAATAATTCATTTGTTTTTTTATCTTAGTATATAAAATTACAAAATACTACCCTCCAAGAATTGCTCCGAGATATTGCATCGCATGACTAAATACCGTTGCGGTTATCATTCGGTCTTGTTCAACATCTACGTCGCGAGAATTGCATGCAAATCTAGAACTCAGATTCATAAATCTCCGAAAATCTGCTTGAATGA...

CDS

Download CDS FASTA

1569 bp · TkA07G428360|TK1151|CDS

ATGAATCAATCTTCACACACTACAAACAACACTCCCATGGATCCAAACCCCAAAAACTTCCCAATTCTCTCCTACGTCATGACCAGACTGCCCACCATGAAACACCCCAACATGCACGAAGGCGACATTGAAACGGCGACGCCGCGTTCCGCTACTTTTGTAACCCCTAAAACGTCTTTTAATCCGGCACCGAATTTCGAGCTCACTGAACGGATGCCTCACCTATCAGATCCTCAGCTCATGGCTTCCATGCGTTCCGC...

Protein

Download Protein FASTA

522 aa · TkA07G428360|TK1151|PROTEIN

MNQSSHTTNNTPMDPNPKNFPILSYVMTRLPTMKHPNMHEGDIETATPRSATFVTPKTSFNPAPNFELTERMPHLSDPQLMASMRSAVADVSQTRSLLKTLGDRPDHEAVDAAKARLAEIESKFSNDLDEIKLSDKVDPEEEKQKKAIERERQMHKTLISLDQMHKSYDKMLSEAEKKLEKLYESVNAGKQSLQDIDEGSSGVTEEVKEEVVAILSDAMSNGAERIDLSERRLPFLPEAFGKIRTLVYLNLSSNQLEVIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G428360
TK1151 IDTkA07G428360
OH-1004 IDLXL04_030746
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)75.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G428360
LocationChr07:108336920-108339260 (+)
DescriptionSimilar to PIRL1: Plant intracellular Ras-group-related LRR protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g05850 Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.
PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6
Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5
At3g11330 Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.
PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6
Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5
At1g12970 Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0593600 Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction. No verified direct reference in this release
Os04g0476700 Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030746 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009416 response to light stimulus Biological Process
GO:0009555 pollen development Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0055046 microgametogenesis Biological Process
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT3G11330
ath:AT3G26500
ath:AT5G05850
dosa:Os02g0593600
dosa:Os04g0476700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.297
Rank 1 · TkA07G428360 · TK1151
Cell membrane0.262
Rank 2 · TkA07G428360 · TK1151
Nucleus0.247
Rank 3 · TkA07G428360 · TK1151
Golgi apparatus0.113
Rank 4 · TkA07G428360 · TK1151
Plastid0.102
Rank 5 · TkA07G428360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11712Vma1251-83 aa
PF20667Sec10_N120-197 aa
PF21121Nup49_C122-131 aa
PF00378ECH_1126-205 aa
PF23406ZNF380_CC131-183 aa
PF11712Vma12137-215 aa
PF30842LEKR1138-210 aa
PF25368PUB10_N138-211 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G428360PF11712Vma1251830.9710.1
TkA07G428360PF20667Sec10_N1201972.19.2
TkA07G428360PF21121Nup49_C1221310.07614.3
TkA07G428360PF00378ECH_11262050.2211.6
TkA07G428360PF23406ZNF380_CC1311830.0216.1
TkA07G428360PF11712Vma121372150.9710.1
TkA07G428360PF30842LEKR11382100.05914.4
TkA07G428360PF25368PUB10_N1382115.08.5
TkA07G428360PF23598LRR_141521833.2e-2795.9
TkA07G428360PF21121Nup49_C1602170.07614.3
TkA07G428360PF24758LRR_At5g563702212790.0003221.1
TkA07G428360PF00560LRR_12252424.1e-1965.3
TkA07G428360PF23286LRR_132332778e-0626.4
TkA07G428360PF24048LRR_NXF1-52362800.0005920.2
TkA07G428360PF13855LRR_82372797.2e-2896.9
TkA07G428360PF23598LRR_142403193.2e-2795.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FFJ3Arabidopsis thalianasp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 161.300%Swiss-ProtHigh
Q8VYG9Arabidopsis thalianasp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 962.400%Swiss-ProtHigh
Q8W4Q3Arabidopsis thalianasp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 351.100%Swiss-ProtHigh
Q6ZH85Oryza sativa subsp. japonicasp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 254.500%Swiss-ProtHigh
Q7XK44Oryza sativa subsp. japonicasp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 357.500%Swiss-ProtHigh

JBrowse

View in Genome Browser