LXL04_030746 | RubberDandelionOmics

Gene overview

LXL04_030746

Reference: OH-1004 Chr: Chr06 Coordinates: 121938344-121940161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_030746|LXL04_030746|OH1004|cDNA

ATGAATCAATCTTCACACACTACAAACAACACTCCCATGGATCCAAACCCCAAAAACTTCCCAATTCTCTCCTACGTCATGACCAGACTGCCCACCATGAAACACCCCAACATGCACGAAGGCGACATTGAAACGGCGACGCCGCGTTCCGCTACTTTTGTAACCCCTAAAACGTCTTTTAATCCGGCACCGAATTTCGAGCTCACTGAACGGATGCCTCACCTATCAGATCCTCAGCTCATGGCTTCCATGCGTTCCGC...

CDS

Download CDS FASTA

1743 bp · LXL04_030746|LXL04_030746|OH1004|CDS

ATGAATCAATCTTCACACACTACAAACAACACTCCCATGGATCCAAACCCCAAAAACTTCCCAATTCTCTCCTACGTCATGACCAGACTGCCCACCATGAAACACCCCAACATGCACGAAGGCGACATTGAAACGGCGACGCCGCGTTCCGCTACTTTTGTAACCCCTAAAACGTCTTTTAATCCGGCACCGAATTTCGAGCTCACTGAACGGATGCCTCACCTATCAGATCCTCAGCTCATGGCTTCCATGCGTTCCGC...

Protein

Download Protein FASTA

580 aa · LXL04_030746|LXL04_030746|OH1004|PROTEIN

MNQSSHTTNNTPMDPNPKNFPILSYVMTRLPTMKHPNMHEGDIETATPRSATFVTPKTSFNPAPNFELTERMPHLSDPQLMASMRSAVADVSQTRSLLKTLGDRPDHEAVDAAKARLAEIESKFSNDLDEIKLSDKVDPEEEKQKKAIERERQMHKTLISLDQMHKSYDKMLSEAEKKLEKLYESVNAGKQSLQDIDEGSSGVTEEVKEEVVAILSDAMSNGAERIDLSERRLPFLPEAFGKIRTLVYLNLSSNQLEVSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030746`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030746

Location Chr06:121938344-121940161 (+)

Description Similar to PIRL1: Plant intracellular Ras-group-related LRR protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05850`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6 Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5
`At3g11330`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6 Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5
`At3g26500`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0476700`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`Os02g0593600`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030746 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009555 pollen development Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G11330

ath:AT3G26500

ath:AT5G05850

dosa:Os02g0593600

dosa:Os04g0476700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.319

Rank 1 · LXL04_030746 · OH-1004

Nucleus0.270

Rank 2 · LXL04_030746 · OH-1004

Cell membrane0.190

Rank 3 · LXL04_030746 · OH-1004

Golgi apparatus0.122

Rank 4 · LXL04_030746 · OH-1004

Endoplasmic reticulum0.113

Rank 5 · LXL04_030746 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8313-360 aa

PF23598.2LRR_14317-376 aa

PF12799.14LRR_4326-364 aa

PF13855.13LRR_8371-430 aa

PF23598.2LRR_14393-449 aa

PF12799.14LRR_4418-459 aa

PF13855.13LRR_8427-478 aa

PF13855.13LRR_8441-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030746	`PF13855.13`	LRR_8	313	360	4e-26	91.3
LXL04_030746	`PF23598.2`	LRR_14	317	376	2.5e-23	83.1
LXL04_030746	`PF12799.14`	LRR_4	326	364	7.6e-23	80.7
LXL04_030746	`PF13855.13`	LRR_8	371	430	4e-26	91.3
LXL04_030746	`PF23598.2`	LRR_14	393	449	2.5e-23	83.1
LXL04_030746	`PF12799.14`	LRR_4	418	459	7.6e-23	80.7
LXL04_030746	`PF13855.13`	LRR_8	427	478	4e-26	91.3
LXL04_030746	`PF13855.13`	LRR_8	441	501	4e-26	91.3
LXL04_030746	`PF23598.2`	LRR_14	454	499	2.5e-23	83.1
LXL04_030746	`PF12799.14`	LRR_4	466	500	7.6e-23	80.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFJ3`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 1	45.694%	Swiss-Prot	moderate database homology
`Q8VYG9`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 9	43.229%	Swiss-Prot	moderate database homology
`Q9LRV8`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 2	38.324%	Swiss-Prot	moderate database homology
`Q7XK44`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 3	42.146%	Swiss-Prot	moderate database homology
`Q6ZH85`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 2	39.616%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card