TkA07G408090 | RubberDandelionOmics

Gene overview

TkA07G408090

Reference: TK1151 Chr: Chr07 Coordinates: 102609369-102612223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1507 bp · TkA07G408090|TK1151|cDNA

GCCAAATTAGGGTTCTCTTCTAGACTTTTGAAACCTGAAGGAGAAAAAAGAGGCCGTATACGGTGTGGCTTCTCAATTGGCAGCAATTTTCAAGAGTAACAGATTCAATCGCATCTCTAATTAATATCAATACACAAAATAAGCAAAAGTGACTATATTGTAAAAAGTAGGGACACTAAAAACCATAACCAGAACCATGGCAACTGCGGTTATGTCTGAATCACTTCAGTCTCTTGATCGCAACTGGTATTTCAGCAGAA...

CDS

Download CDS FASTA

1086 bp · TkA07G408090|TK1151|CDS

ATGGCAACTGCGGTTATGTCTGAATCACTTCAGTCTCTTGATCGCAACTGGTATTTCAGCAGAAAAGAGATAGAATCCCATACTCCATCAAGATCTGATGGCATTGATTACAAAAATGAGCAAAATCTTAGAAAACTCTACTGCTCTTTTCTTCAAGAACTTGGCATAGAGCTTAAAGTACCCCAAGTAACAATAGCTACAGCCATGATGTTTTGCCATAGGTTTTACATGCGACAATCTCATGTGAAAAACAATTGGCA...

Protein

Download Protein FASTA

361 aa · TkA07G408090|TK1151|PROTEIN

MATAVMSESLQSLDRNWYFSRKEIESHTPSRSDGIDYKNEQNLRKLYCSFLQELGIELKVPQVTIATAMMFCHRFYMRQSHVKNNWQTVATACMFLACKAEETPRFLGELVVVAYKLIYKSDPSASRRIREIYDKQKDLVLIAERLLLITIAFDLNIEHPYKSLVAAVKSLDITHKELVKVAWNFVNDWLRTSLCLQHKPHYIAAGSLCLAAKVKKVKLPSSNGKAWWMEFNVSPKQLEEVIQQMMTILEHSQTPTPKPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G408090`
TK1151 ID	TkA07G408090
OH-1004 ID	LXL04_026090
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.500
Protein coverage (%)	TK1151 94.460 / OH-1004 75.460 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G408090

Location Chr07:102609369-102612223 (-)

Description Similar to CYCT1-3: Cyclin-T1-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45190`	Cyclin-T1-5.	No verified direct reference in this release
`At4g19600`	Cyclin-T1-4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0485400`	Cyclin-T1-4.	No verified direct reference in this release
`Os11g0157100`	Cyclin-T1-3.	No verified direct reference in this release
`Os02g0438200`	Cyclin-T1-2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009615 response to virus Biological Process

GO:0009908 flower development Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0032786 positive regulation of DNA-templated transcription, elongation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050792 regulation of viral process Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0008024 cyclin/CDK positive transcription elongation factor complex Cellular Component

GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G19600

ath:AT5G45190

dosa:Os11g0157100

dosa:Os12g0485400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA07G408090 · TK1151

Cytoplasm0.144

Rank 2 · TkA07G408090 · TK1151

Cell membrane0.024

Rank 3 · TkA07G408090 · TK1151

Mitochondrion0.019

Rank 4 · TkA07G408090 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA07G408090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134Cyclin_N18-156 aa

PF00382TFIIB49-113 aa

PF29928BUR2_N50-137 aa

PF02984Cyclin_C65-99 aa

PF21797CycT2-like_C70-99 aa

PF00382TFIIB162-218 aa

PF21797CycT2-like_C164-247 aa

PF02984Cyclin_C170-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G408090	`PF00134`	Cyclin_N	18	156	2.9e-24	85.9
TkA07G408090	`PF00382`	TFIIB	49	113	9.5e-05	23.1
TkA07G408090	`PF29928`	BUR2_N	50	137	0.04	14.7
TkA07G408090	`PF02984`	Cyclin_C	65	99	0.00011	22.9
TkA07G408090	`PF21797`	CycT2-like_C	70	99	3.8e-06	27.3
TkA07G408090	`PF00382`	TFIIB	162	218	9.5e-05	23.1
TkA07G408090	`PF21797`	CycT2-like_C	164	247	3.8e-06	27.3
TkA07G408090	`PF02984`	Cyclin_C	170	251	0.00011	22.9
TkA07G408090	`PF00134`	Cyclin_N	175	250	2.9e-24	85.9
TkA07G408090	`PF29928`	BUR2_N	227	249	0.04	14.7
TkA07G408090	`PF00382`	TFIIB	310	327	9.5e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKE6`	Arabidopsis thaliana	sp\|Q9FKE6\|CCT15_ARATH Cyclin-T1-5	59.300%	Swiss-Prot	Medium
`Q8GYM6`	Arabidopsis thaliana	sp\|Q8GYM6\|CCT14_ARATH Cyclin-T1-4	57.700%	Swiss-Prot	Medium
`Q2QQS5`	Oryza sativa subsp. japonica	sp\|Q2QQS5\|CCT14_ORYSJ Cyclin-T1-4	60.100%	Swiss-Prot	Medium
`Q2RAC5`	Oryza sativa subsp. japonica	sp\|Q2RAC5\|CCT13_ORYSJ Cyclin-T1-3	44.400%	Swiss-Prot	Medium
`Q6Z7H3`	Oryza sativa subsp. japonica	sp\|Q6Z7H3\|CCT12_ORYSJ Cyclin-T1-2	56.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card