LXL04_026090 | RubberDandelionOmics

Gene overview

LXL04_026090

Reference: OH-1004 Chr: Chr05 Coordinates: 120754200-120757998 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1470 bp · LXL04_026090|LXL04_026090|OH1004|cDNA

ATGAGTGGTTTGTTGTCAAATGATCCTATGCATTTTGGAAGTTATGAAGGTGGTCCTTACAGGAATTCAGATGATAATGCAGAAGAAAATGGAGGTAGGTGGTATTTTTCACGTAAAGAAATAGAGGAAAACTCTCCATCAAGACCAGATGGCATTGATTTGAAGAAGGAGACTTATTTGCGTAAAGCATATTGCACATTTTTGCAAGACTTGGGTATGCGGCTTAAAGTGCCCCAGGTAACTATTGCTACAGCTATAAT...

CDS

Download CDS FASTA

1470 bp · LXL04_026090|LXL04_026090|OH1004|CDS

ATGAGTGGTTTGTTGTCAAATGATCCTATGCATTTTGGAAGTTATGAAGGTGGTCCTTACAGGAATTCAGATGATAATGCAGAAGAAAATGGAGGTAGGTGGTATTTTTCACGTAAAGAAATAGAGGAAAACTCTCCATCAAGACCAGATGGCATTGATTTGAAGAAGGAGACTTATTTGCGTAAAGCATATTGCACATTTTTGCAAGACTTGGGTATGCGGCTTAAAGTGCCCCAGGTAACTATTGCTACAGCTATAAT...

Protein

Download Protein FASTA

489 aa · LXL04_026090|LXL04_026090|OH1004|PROTEIN

MSGLLSNDPMHFGSYEGGPYRNSDDNAEENGGRWYFSRKEIEENSPSRPDGIDLKKETYLRKAYCTFLQDLGMRLKVPQVTIATAIIFCHRFFLRQSHAKNDRRTVATVCMFLAGKVEETPRPLKDVILVSYEINNKKDPEAIQRIKQKEVYEQQKELILLGERVVLATLGFDFNVHHPYKPLVEAIKKFKVAQNALAQVAWNFVNDGLRTSLCLQFKPHHIAAGAIFLAAKFLKVKLPSDGEKVWWQEFDVTPRQLEEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026090`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026090

Location Chr05:120754200-120757998 (-)

Description Similar to CYCT1-3: Cyclin-T1-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19600`	Cyclin-T1-4.	No verified direct reference in this release
`At5g45190`	Cyclin-T1-5.	No verified direct reference in this release
`At4g19560`	Cyclin-T1-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0157100`	Cyclin-T1-3.	No verified direct reference in this release
`Os12g0485400`	Cyclin-T1-4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026090 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009615 response to virus Biological Process

GO:0009908 flower development Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0032786 positive regulation of DNA-templated transcription, elongation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050792 regulation of viral process Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0008024 cyclin/CDK positive transcription elongation factor complex Cellular Component

GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G19600

ath:AT5G45190

dosa:Os11g0157100

dosa:Os12g0485400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_026090 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_026090 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_026090 · OH-1004

Mitochondrion0.012

Rank 4 · LXL04_026090 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_026090 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134.29Cyclin_N40-174 aa

PF21797.3CycT2-like_C178-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026090	`PF00134.29`	Cyclin_N	40	174	4.5e-23	82.1
LXL04_026090	`PF21797.3`	CycT2-like_C	178	265	1.6e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYM6`	Arabidopsis thaliana	Cyclin-T1-4	62.144%	Swiss-Prot	strong database homology
`Q9FKE6`	Arabidopsis thaliana	Cyclin-T1-5	82.935%	Swiss-Prot	moderate database homology
`Q56YF8`	Arabidopsis thaliana	Cyclin-T1-2	50.588%	Swiss-Prot	strong database homology
`Q2RAC5`	Oryza sativa subsp. japonica	Cyclin-T1-3	64.659%	Swiss-Prot	strong database homology
`Q2QQS5`	Oryza sativa subsp. japonica	Cyclin-T1-4	81.757%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card