RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G284760
Reference: TK1151 Chr: Chr07 Coordinates: 71441972-71447377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2918 bp · TkA07G284760|TK1151|cDNA

AAATTTCCCGGTGTTAAAGTCGATCAGAAAGTCAGAAACCAACAAAATCGGCAAAAAGCAAGAGGGAATCTAGAGATAAACACAACCTCAGCAAACCTGACTGTAACATGTAACATGGTGATCGTTTCCCTGCCTTAAGCATCTTGCTTGGTGGGGTTTCTGTTTTTTCTTCTTTTTATTTTTATAAAATCTTTTGCCGGTTCAAAAAAAAAAAAAGCAAACCTGACTCTCGAACTCTCTTCCTCGCTCGTCGGAAACGG...

CDS

Download CDS FASTA

2130 bp · TkA07G284760|TK1151|CDS

ATGTCTCATATCAGAGAGTTTGAACACCTCAAAATAACGCTAGAAGCTATAAAATCTGCAACCAACAACTTTGCTCCTGAGAATTGTATAGGGAGAGGAGGATTTGGGAATGTGTATAAAGGAGAAATTGTCCATTCCAGGGGCCGTTCCATGGTTGCTTTTAAGCGCTTAGACTGTGCATTTGGGCAAGGAAACCCAGAGTTTTGGAAGGAAATCACAATGCTATCGATTTACAAGCATACAAATTTGGTTTGTCTTTT...

Protein

Download Protein FASTA

709 aa · TkA07G284760|TK1151|PROTEIN

MSHIREFEHLKITLEAIKSATNNFAPENCIGRGGFGNVYKGEIVHSRGRSMVAFKRLDCAFGQGNPEFWKEITMLSIYKHTNLVCLLGFCDESDEKILVYEYASKRSLDLHLDSNDLTWTQRLKICIGVARGLSYLHNSETNVRVLHRDIKSSNILLDENWNAKLSDFGLSKFARADKFTFLFTCAVGTLGYCDPLYAETGFLTKESDIYSLGVVLFEVLCGRLCIDKKDGHPLTGLARHCYELNKVDSIIFSSMVDEIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G284760
TK1151 IDTkA07G284760
OH-1004 IDLXL04_029207
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G284760
LocationChr07:71441972-71447377 (+)
DescriptionSimilar to TPR2: Protein TOPLESS-RELATED PROTEIN 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g27030 Transcriptional corepressor. No verified direct reference in this release
At3g16830 Transcriptional corepressor. No verified direct reference in this release
At1g15750 Transcriptional corepressor. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0162100 Transcriptional corepressor involved in branch formation regulation, presumably by suppressing primary branch formation and promoting secondary branch formation.
OsLIS-L1 encoding a lissencephaly type-1-like protein with WD40 repeats is required for plant height and male gametophyte formation in rice.2012 · DOI: 10.1007/s00425-011-1532-7
Os01g0254100 Probable downstream regulator of strigolactones signaling. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029207 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010072 primary shoot apical meristem specification Biological Process
GO:0010229 inflorescence development Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0062208 positive regulation of pattern recognition receptor signaling pathway Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G15750
ath:AT3G16830
ath:AT5G27030
dosa:Os01g0254100
dosa:Os08g0162100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455
Rank 1 · TkA07G284760 · TK1151
Nucleus0.324
Rank 2 · TkA07G284760 · TK1151
Cell membrane0.307
Rank 3 · TkA07G284760 · TK1151
Lysosome / Vacuole0.067
Rank 4 · TkA07G284760 · TK1151
Golgi apparatus0.061
Rank 5 · TkA07G284760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-290 aa
PF07714PK_Tyr_Ser-Thr28-292 aa
PF23409Beta-prop_EML74-100 aa
PF23389Beta-prop_WDR19_1st87-144 aa
PF03109ABC193-176 aa
PF24807WD40_CDC20-Fz115-150 aa
PF12894ANAPC4_WD40116-155 aa
PF12330Haspin_kinase118-174 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G284760PF00069Pkinase272902.4e-42145.9
TkA07G284760PF07714PK_Tyr_Ser-Thr282924.3e-38131.8
TkA07G284760PF23409Beta-prop_EML741000.001418.9
TkA07G284760PF23389Beta-prop_WDR19_1st871440.1511.8
TkA07G284760PF03109ABC1931760.211.5
TkA07G284760PF24807WD40_CDC20-Fz1151505.1e-1453.0
TkA07G284760PF12894ANAPC4_WD401161550.000123.2
TkA07G284760PF12330Haspin_kinase1181740.02514.3
TkA07G284760PF12523DUF37251701920.212.7
TkA07G284760PF12523DUF37252693060.212.7
TkA07G284760PF23775Beta-prop_RIG_2nd3684112.2e-0628.0
TkA07G284760PF24780WD40_MABP1-WDR62_1st3924530.0002721.0
TkA07G284760PF24814WD40_Prp193985486.7e-1865.5
TkA07G284760PF24807WD40_CDC20-Fz4025395.1e-1453.0
TkA07G284760PF23869Beta-prop_WDR75_1st4115390.00119.2
TkA07G284760PF24817WD40_WDHD1_1st4126321.7e-1867.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84JM4Arabidopsis thalianasp|Q84JM4|TPR3_ARATH Topless-related protein 357.400%Swiss-ProtHigh
Q9LRZ0Arabidopsis thalianasp|Q9LRZ0|TPR2_ARATH Topless-related protein 255.000%Swiss-ProtHigh
Q94AI7Arabidopsis thalianasp|Q94AI7|TPL_ARATH Protein TOPLESS53.900%Swiss-ProtHigh
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 146.400%Swiss-ProtMedium
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970046.100%Swiss-ProtMedium
Q0J7U6Oryza sativa subsp. japonicasp|Q0J7U6|TPR2_ORYSJ Protein TOPLESS-RELATED PROTEIN 262.700%Swiss-ProtHigh
Q5NBT9Oryza sativa subsp. japonicasp|Q5NBT9|TPR1_ORYSJ Protein TPR156.400%Swiss-ProtHigh

JBrowse

View in Genome Browser