RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G272890
Reference: TK1151 Chr: Chr07 Coordinates: 68215146-68221249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3062 bp · TkA07G272890|TK1151|cDNA

CTCTTCTTCACATGCTTTCTCTCTCTACATTCTCAATGCTCCATTGATTCAACTCTTTGTTTACTCATTGACTGCTTATTTCCACGAGCCACTTTACAGATCTACACAGAAAGAATAGTCTTCTTCAATATGAATTTCAAGAATTGAATAACCGGTATCCCTCATATACGCCAAGACCTACAAATTCATTGAATACAAACATATCTCATGTTTATCCAACTGTTATAAACTGGTGTAAAAAATGGAAGACGACAATGCCG...

CDS

Download CDS FASTA

2664 bp · TkA07G272890|TK1151|CDS

ATGGAAGACGACAATGCCGAGGATATGGAGGTCGAAGCCTTGTCTTCAATGTGGCCGGAAGACATTGATGCCGCCGGAAAAAAGTTCAACGTGGAAACACCAGGCGCCGATCAAGATTTATTAGAGGACGTCACTATCATCGAAGAGCCAACAATCGTGGATTTTAAACGACTACTCGAGCTTACAAATTATAGCGAAAAGGGGTCGTCTCAGTTATCTTACCTCGTGAAAAACTGGGAATGGAAACAAGAAAACGCCGT...

Protein

Download Protein FASTA

887 aa · TkA07G272890|TK1151|PROTEIN

MEDDNAEDMEVEALSSMWPEDIDAAGKKFNVETPGADQDLLEDVTIIEEPTIVDFKRLLELTNYSEKGSSQLSYLVKNWEWKQENAVRLLREELETLSKQQQEVELKKLEILEEHRFEDASYGGDKRPISILDEVYEIVPNAPNPKRRNDVIYQGQRLEIDGEDDTETVKYWKQRALNLETLLQLSINREQILMEKLEESIEKLKKQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQDKELRYRFIYNHFPSLGEQDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G272890
TK1151 IDTkA07G272890
OH-1004 IDLXL04_029115
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.600
Protein coverage (%)TK1151 99.436 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G272890
LocationChr07:68215146-68221249 (+)
DescriptionSimilar to AHK5: Histidine kinase 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g10720 Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade.
AHK5 histidine kinase regulates root elongation through an ETR1-dependent abscisic acid and ethylene signaling pathway in Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl065
The histidine kinase AHK5 integrates endogenous and environmental signals in Arabidopsis guard cells.2008 · DOI: 10.1371/journal.pone.0002491
Arabidopsis histidine kinase 5 regulates salt sensitivity and resistance against bacterial and fungal infection.2012 · DOI: 10.1111/j.1469-8137.2011.04033.x
Modulation of ROS production and hormone levels by AHK5 during abiotic and biotic stress signaling.2012 · DOI: 10.4161/psb.20692

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YFR6 Cytokinin receptor related to bacterial two-component regulators. No verified direct reference in this release
Os06g0654300 Cytokinin receptor related to bacterial two-component regulators. No verified direct reference in this release
Os01g0923700 Cytokinin receptor related to bacterial two-component regulators. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029115 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000160 phosphorelay signal transduction system Biological Process
GO:0006952 defense response Biological Process
GO:0009736 cytokinin-activated signaling pathway Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process
GO:0048364 root development Biological Process
GO:0070301 cellular response to hydrogen peroxide Biological Process
GO:0071219 cellular response to molecule of bacterial origin Biological Process
GO:0071732 cellular response to nitric oxide Biological Process
GO:0090333 regulation of stomatal closure Biological Process
KEGG gene cross-reference
ath:AT5G10720
dosa:Os01g0923700
dosa:Os06g0654300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.492
Rank 1 · TkA07G272890 · TK1151
Nucleus0.332
Rank 2 · TkA07G272890 · TK1151
Cell membrane0.158
Rank 3 · TkA07G272890 · TK1151
Golgi apparatus0.102
Rank 4 · TkA07G272890 · TK1151
Endoplasmic reticulum0.085
Rank 5 · TkA07G272890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00512HisKA87-103 aa
PF06050HGD-D167-223 aa
PF00512HisKA192-208 aa
PF08448PAS_4230-336 aa
PF17202sCache_3_3289-334 aa
PF06050HGD-D341-399 aa
PF08659KR361-411 aa
PF00512HisKA372-435 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G272890PF00512HisKA871032.6e-1866.5
TkA07G272890PF06050HGD-D1672232.38.3
TkA07G272890PF00512HisKA1922082.6e-1866.5
TkA07G272890PF08448PAS_42303360.1213.3
TkA07G272890PF17202sCache_3_32893340.08114.0
TkA07G272890PF06050HGD-D3413992.38.3
TkA07G272890PF08659KR3614111.59.4
TkA07G272890PF00512HisKA3724352.6e-1866.5
TkA07G272890PF02518HATPase_c4816134.8e-2898.5
TkA07G272890PF08659KR5335461.59.4
TkA07G272890PF08659KR5756021.59.4
TkA07G272890PF00072Response_reg7398067.4e-2175.1
TkA07G272890PF08448PAS_48058270.1213.3
TkA07G272890PF00072Response_reg8318777.4e-2175.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3S4A7Arabidopsis thalianasp|Q3S4A7|AHK5_ARATH Histidine kinase 559.100%Swiss-ProtHigh
A2YFR6Oryza sativa subsp. indicasp|A2YFR6|OHK1_ORYSI Probable histidine kinase 152.700%Swiss-ProtHigh
A3BE68Oryza sativa subsp. japonicasp|A3BE68|OHK1_ORYSJ Probable histidine kinase 152.500%Swiss-ProtHigh
A1A696Oryza sativa subsp. japonicasp|A1A696|OHK3_ORYSJ Probable histidine kinase 329.200%Swiss-ProtLow

JBrowse

View in Genome Browser