LXL04_029115 | RubberDandelionOmics

Gene overview

LXL04_029115

Reference: OH-1004 Chr: Chr06 Coordinates: 81208680-81213161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2636 bp · LXL04_029115|LXL04_029115|OH1004|cDNA

TGTAAAAGATGGAAGACGACAATGCCGAGGATATGGAGGTCGAAGCCTTGTCTTCAATGTGGCCGGAAGACATTGATGCCGCCGGAAAAAAGTTCAACGTGGAAACACCAGGCGCCGATCAAGATTTATTAGAGGACGTCACTATCATCGAAGAGCCAACAATCGTTGATTTTAAACGACTACTCGAGCTTACAAATTATAGCGAAAAGGGGTCGTCTCAGTTATCTTACCTCGTAAAAAACTGGGAATGGAAACAAGAA...

CDS

Download CDS FASTA

2613 bp · LXL04_029115|LXL04_029115|OH1004|CDS

ATGGAAGACGACAATGCCGAGGATATGGAGGTCGAAGCCTTGTCTTCAATGTGGCCGGAAGACATTGATGCCGCCGGAAAAAAGTTCAACGTGGAAACACCAGGCGCCGATCAAGATTTATTAGAGGACGTCACTATCATCGAAGAGCCAACAATCGTTGATTTTAAACGACTACTCGAGCTTACAAATTATAGCGAAAAGGGGTCGTCTCAGTTATCTTACCTCGTAAAAAACTGGGAATGGAAACAAGAAAACGCCGT...

Protein

Download Protein FASTA

870 aa · LXL04_029115|LXL04_029115|OH1004|PROTEIN

MEDDNAEDMEVEALSSMWPEDIDAAGKKFNVETPGADQDLLEDVTIIEEPTIVDFKRLLELTNYSEKGSSQLSYLVKNWEWKQENAVRLLREELETLSKQQQEVELKKLEILEEHRFEDASYGGDKRPISILDEVYEIVPDVPNPKRRNDVIYQGQRLEIDGEDDTETVKYWKQRALNLETLLQLSINREQILMEKLEESIEKLKKQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQDKELRYRFIYNHFPSLGEQDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029115`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029115

Location Chr06:81208680-81213161 (+)

Description Similar to AHK5: Histidine kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10720`	Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade.	AHK5 histidine kinase regulates root elongation through an ETR1-dependent abscisic acid and ethylene signaling pathway in Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl065 The histidine kinase AHK5 integrates endogenous and environmental signals in Arabidopsis guard cells.2008 · DOI: 10.1371/journal.pone.0002491 Arabidopsis histidine kinase 5 regulates salt sensitivity and resistance against bacterial and fungal infection.2012 · DOI: 10.1111/j.1469-8137.2011.04033.x Modulation of ROS production and hormone levels by AHK5 during abiotic and biotic stress signaling.2012 · DOI: 10.4161/psb.20692

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFR6`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os06g0654300`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os01g0923700`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`UniProt: A2WYI4`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029115 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006952 defense response Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0071732 cellular response to nitric oxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT5G10720

dosa:Os01g0923700

dosa:Os06g0654300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · LXL04_029115 · OH-1004

Nucleus0.340

Rank 2 · LXL04_029115 · OH-1004

Cell membrane0.136

Rank 3 · LXL04_029115 · OH-1004

Golgi apparatus0.098

Rank 4 · LXL04_029115 · OH-1004

Endoplasmic reticulum0.083

Rank 5 · LXL04_029115 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00512.32HisKA372-435 aa

PF02518.32HATPase_c473-605 aa

PF00072.31Response_reg727-794 aa

PF00072.31Response_reg819-865 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029115	`PF00512.32`	HisKA	372	435	5.8e-18	65.4
LXL04_029115	`PF02518.32`	HATPase_c	473	605	4.8e-28	98.5
LXL04_029115	`PF00072.31`	Response_reg	727	794	6.9e-21	75.2
LXL04_029115	`PF00072.31`	Response_reg	819	865	6.9e-21	75.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3S4A7`	Arabidopsis thaliana	Histidine kinase 5	58.405%	Swiss-Prot	strong database homology
`A2YFR6`	Oryza sativa subsp. indica	Probable histidine kinase 1	51.833%	Swiss-Prot	strong database homology
`A3BE68`	Oryza sativa subsp. japonica	Probable histidine kinase 1	51.170%	Swiss-Prot	strong database homology
`A1A696`	Oryza sativa subsp. japonica	Probable histidine kinase 3	29.340%	Swiss-Prot	weak database homology
`A2WYI4`	Oryza sativa subsp. indica	Probable histidine kinase 3	29.167%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card